Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit
Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit
To Order Contact us:
![]() Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
RDR-bCMO1-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 544 |
![]() Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
RDR-bCMO1-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 756 |
![]() Recombinant Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) |
|||
4-RPE246Hu01 | Cloud-Clone |
|
|
Description: Recombinant Human Beta-Carotene-15,15'-Monooxygenase 1 expressed in: E.coli |
![]() Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Antibody |
|||
20-abx130708 | Abbexa |
|
|
![]() beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
|||
abx122471-100ug | Abbexa | 100 ug | EUR 391 |
![]() Beta-Carotene-15,15-Monooxygenase 1 (bCMO1) Antibody |
|||
20-abx171410 | Abbexa |
|
|
![]() beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
|||
abx230851-100ug | Abbexa | 100 ug | EUR 481 |
![]() beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
|||
abx025732-400ul | Abbexa | 400 ul | EUR 523 |
![]() beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
|||
abx025732-80l | Abbexa | 80 µl | EUR 286 |
![]() Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
SEE246Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 4731.5 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
![]() Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
SEE246Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 477.3 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
![]() Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
SEE246Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 639 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
![]() Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
SEE246Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 2575.5 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
![]() Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
20-abx150797 | Abbexa |
|
|
![]() Human Beta,beta- carotene 15,15'- monooxygenase, BCMO1 ELISA KIT |
|||
ELI-10937h | Lifescience Market | 96 Tests | EUR 824 |
![]() Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Protein |
|||
20-abx650585 | Abbexa |
|
|
![]() Mouse Beta,beta- carotene 15,15'- monooxygenase, Bcmo1 ELISA KIT |
|||
ELI-11036m | Lifescience Market | 96 Tests | EUR 865 |
![]() Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) CLIA Kit |
|||
20-abx494551 | Abbexa |
|
|
![]() ELISA kit for Human bCMO1 (Beta-Carotene-15,15'-Monooxygenase 1) |
|||
ELK4791 | ELK Biotech | 1 plate of 96 wells | EUR 432 |
Description: A sandwich ELISA kit for detection of Beta-Carotene-15,15'-Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
![]() Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
4-SEE246Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species. |
![]() Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human) |
|||
4-PAE246Hu01 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) |
![]() Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC |
|||
4-PAE246Hu01-APC | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC. |
![]() Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Biotinylated |
|||
4-PAE246Hu01-Biotin | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Biotin. |
![]() Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Cy3 |
|||
4-PAE246Hu01-Cy3 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Cy3. |
![]() Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), FITC |
|||
4-PAE246Hu01-FITC | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with FITC. |
![]() Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), HRP |
|||
4-PAE246Hu01-HRP | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with HRP. |
![]() Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), PE |
|||
4-PAE246Hu01-PE | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with PE. |
![]() Human Beta,beta-carotene 15,15'-dioxygenase (BCO1) ELISA Kit |
|||
abx392200-96tests | Abbexa | 96 tests | EUR 911 |
![]() Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC-Cy7 |
|||
4-PAE246Hu01-APC-Cy7 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC-Cy7. |
![]() Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody |
|||
20-abx310811 | Abbexa |
|
|
![]() Mouse Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit |
|||
abx388677-96tests | Abbexa | 96 tests | EUR 911 |
![]() Rat Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit |
|||
abx391017-96tests | Abbexa | 96 tests | EUR 911 |
![]() Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (HRP) |
|||
20-abx310812 | Abbexa |
|
|
![]() Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (FITC) |
|||
20-abx310813 | Abbexa |
|
|
![]() Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (Biotin) |
|||
20-abx310814 | Abbexa |
|
|
![]() Human beta carotene |
|||
QY-E05643 | Qayee Biotechnology | 96T | EUR 361 |
![]() Beta-Carotene |
|||
TB0299 | ChemNorm | 8XX100mg | EUR 274 |
![]() beta-Carotene |
|||
GP8334-10G | Glentham Life Sciences | 10 g | EUR 102 |
![]() beta-Carotene |
|||
GP8334-1G | Glentham Life Sciences | 1 g | EUR 48 |
![]() beta-Carotene |
|||
GP8334-25G | Glentham Life Sciences | 25 g | EUR 174 |
![]() beta-Carotene |
|||
GP8334-5G | Glentham Life Sciences | 5 g | EUR 74 |
![]() Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed |
|||
ELISA-1 | Alpha Diagnostics | 1 | EUR 202 |
![]() Bcmo1/ Rat Bcmo1 ELISA Kit |
|||
ELI-33406r | Lifescience Market | 96 Tests | EUR 886 |
![]() Human Beta,beta- carotene 9',10'- oxygenase, BCO2 ELISA KIT |
|||
ELI-49386h | Lifescience Market | 96 Tests | EUR 824 |
![]() Human Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit |
|||
abx250481-96tests | Abbexa | 96 tests | EUR 668 |
![]() Human BCO2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit |
|||
E0265Hu | Sunlong | 1 Kit | EUR 605 |
![]() ELISA kit for Human Beta,beta-carotene 9',10'-oxygenase |
|||
EK2713 | SAB | 96 tests | EUR 553 |
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Beta,beta-carotene 9',10'-oxygenase in samples from serum, plasma, tissue homogenates and other biological fluids. |
![]() Human BCO2(Beta,beta-carotene 9',10'-oxygenase) ELISA Kit |
|||
EH1224 | FN Test | 96T | EUR 567.6 |
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.469 ng/ml |
![]() Mouse Beta,beta- carotene 9',10'- oxygenase, Bco2 ELISA KIT |
|||
ELI-49387m | Lifescience Market | 96 Tests | EUR 865 |
![]() Mouse Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit |
|||
abx515122-96tests | Abbexa | 96 tests | EUR 739 |
![]() Mouse Bco2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit |
|||
E0170Mo | Sunlong | 1 Kit | EUR 632 |
![]() Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit |
|||
EI2200-1 | AssayPro | 96 Well Plate | EUR 477 |
![]() BCMO1 ELISA Kit (Human) (OKCD04382) |
|||
OKCD04382 | Aviva Systems Biology | 96 Wells | EUR 831 |
Description: Description of target: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich ELISA;Sensitivity: 0.49 ng/mL |
![]() Chicken BCMO1 ELISA KIT |
|||
ELI-25375c | Lifescience Market | 96 Tests | EUR 928 |
![]() Human TGF-beta-1 AssayMax ELISA Kit |
|||
ET3102-1 | AssayPro | 96 Well Plate | EUR 477 |
![]() Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody |
|||
abx122472-100ug | Abbexa | 100 ug | EUR 391 |
![]() Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody |
|||
abx230852-100ug | Abbexa | 100 ug | EUR 481 |
![]() Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody |
|||
20-abx003844 | Abbexa |
|
|
![]() YWHAB Tyr-3/Trp- 5 Monooxygenase Activation Protein Beta Human Recombinant Protein |
|||
PROTP31946-1 | BosterBio | Regular: 25ug | EUR 317 |
Description: YWHAB Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and having a molecular mass of 28kDa. ;YWHAB is purified by proprietary chromatographic techniques. |
![]() Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit |
|||
EMI2200-1 | AssayPro | 96 Well Plate | EUR 477 |
![]() alpha-Carotene |
|||
TBZ2607 | ChemNorm | 5mg | Ask for price |
![]() β-Carotene |
|||
HY-N0411 | MedChemExpress | 50mg | EUR 108 |
![]() Human Methylsterol monooxygenase 1, MSMO1 ELISA KIT |
|||
ELI-23191h | Lifescience Market | 96 Tests | EUR 824 |
![]() Human Methylsterol monooxygenase 1 (MSMO1) ELISA Kit |
|||
abx385151-96tests | Abbexa | 96 tests | EUR 911 |
![]() BCMO1 siRNA |
|||
20-abx909008 | Abbexa |
|
|
![]() BCMO1 siRNA |
|||
20-abx909009 | Abbexa |
|
|
![]() Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
SEF458Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 4731.5 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
![]() Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
SEF458Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 477.3 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
![]() Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
SEF458Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 639 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
![]() Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
SEF458Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 2575.5 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
![]() Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
4-SEF458Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
![]() Human Monooxygenase DBH Like 1 (MOXD1) ELISA Kit |
|||
abx381498-96tests | Abbexa | 96 tests | EUR 911 |
![]() Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
20-abx151570 | Abbexa |
|
|
![]() Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
DLR-FMO1-Hu-48T | DL Develop | 48T | EUR 517 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids. |
![]() Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
DLR-FMO1-Hu-96T | DL Develop | 96T | EUR 673 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids. |
![]() Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
RD-FMO1-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 521 |
![]() Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
RD-FMO1-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 723 |
![]() Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
RDR-FMO1-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 544 |
![]() Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
RDR-FMO1-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 756 |
![]() BCMO1 Recombinant Protein (Human) |
|||
RP036973 | ABM | 100 ug | Ask for price |
![]() BCMO1 Recombinant Protein (Human) |
|||
RP036976 | ABM | 100 ug | Ask for price |
![]() Human BCMO1 shRNA Plasmid |
|||
20-abx959976 | Abbexa |
|
|
![]() Human Alkylglycerol monooxygenase, AGMO ELISA KIT |
|||
ELI-24195h | Lifescience Market | 96 Tests | EUR 824 |
![]() Kynurenine 3-monooxygenase ELISA Kit|Human |
|||
EF005180 | Lifescience Market | 96 Tests | EUR 689 |
![]() Human Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E01A2009-192T | BlueGene | 192 tests | EUR 1270 |
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E01A2009-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E01A2009-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Squalene monooxygenase, SQLE ELISA KIT |
|||
ELI-32784h | Lifescience Market | 96 Tests | EUR 824 |
![]() Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit |
|||
201-12-2419 | SunredBio | 96 tests | EUR 440 |
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
![]() Human SQLE/ Squalene monooxygenase ELISA Kit |
|||
E2385Hu | Sunlong | 1 Kit | EUR 605 |
![]() Human Alkylglycerol Monooxygenase(AGMO)ELISA Kit |
|||
QY-E01119 | Qayee Biotechnology | 96T | EUR 361 |
![]() Chicken Methylsterol monooxygenase 1, MSMO1 ELISA KIT |
|||
ELI-23404c | Lifescience Market | 96 Tests | EUR 928 |
![]() Porcine Methylsterol monooxygenase 1, MSMO1 ELISA KIT |
|||
ELI-42078p | Lifescience Market | 96 Tests | EUR 928 |
![]() Mouse Methylsterol monooxygenase 1, Msmo1 ELISA KIT |
|||
ELI-45646m | Lifescience Market | 96 Tests | EUR 865 |
![]() Mouse Methylsterol monooxygenase 1 (MSMO1) ELISA Kit |
|||
abx389876-96tests | Abbexa | 96 tests | EUR 911 |
![]() Rat Methylsterol monooxygenase 1 (MSMO1) ELISA Kit |
|||
abx391608-96tests | Abbexa | 96 tests | EUR 911 |
![]() ExoAb Antibody Kit (CD9, CD63, CD81, Hsp70 antibodies, rabbit anti-human) with goat anti-rabbit HRP secondary antibody |
|||
EXOAB-KIT-1 | SBI | 25 ul each | EUR 627 |
![]() PinPoint-FC 293T Platform Kit for Targeted Gene Insertion (includes PIN320A-1, PIN200A-1, PIN510A-1 & PIN600A-1) |
|||
PIN320A-KIT | SBI | 1 Kit | EUR 4941 |
![]() BCMO1 sgRNA CRISPR Lentivector (Human) (Target 1) |
|||
K0177302 | ABM | 1.0 ug DNA | EUR 154 |
![]() PinPoint-FC Murine iPSC Platform Kit for Targeted Gene Insertion (includes PIN340iPS-1, PIN200A-1, PIN510A-1 & PIN600A-1) |
|||
PIN340iPS-KIT | SBI | 1 Kit | EUR 4941 |
![]() mRNAExpress mRNA Synthesis kit (5 reactions) |
|||
MR-KIT-1 | SBI | 5 reactions | EUR 1152 |
![]() Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx241015 | Abbexa |
|
|
![]() Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx241094 | Abbexa |
|
|
![]() Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx214774 | Abbexa |
|
|
![]() Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx214826 | Abbexa |
|
|
![]() Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx329250 | Abbexa |
|
|
![]() Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
abx332554-100ul | Abbexa | 100 ul | EUR 425 |
![]() Msmo1 ELISA Kit| Rat Methylsterol monooxygenase 1 ELISA Kit |
|||
EF018966 | Lifescience Market | 96 Tests | EUR 689 |
![]() Msmo1 ELISA Kit| Mouse Methylsterol monooxygenase 1 ELISA Kit |
|||
EF015513 | Lifescience Market | 96 Tests | EUR 689 |
![]() MSMO1 ELISA Kit| chicken Methylsterol monooxygenase 1 ELISA Kit |
|||
EF012392 | Lifescience Market | 96 Tests | EUR 689 |
![]() Human DBH- like monooxygenase protein 1, MOXD1 ELISA KIT |
|||
ELI-43781h | Lifescience Market | 96 Tests | EUR 824 |
![]() ELISA kit for Human FMO1 (Flavin Containing Monooxygenase 1) |
|||
ELK4594 | ELK Biotech | 1 plate of 96 wells | EUR 432 |
Description: A sandwich ELISA kit for detection of Flavin Containing Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
![]() Anti-BCMO1 antibody |
|||
PAab00851 | Lifescience Market | 100 ug | EUR 355 |
![]() BCMO1 cloning plasmid |
|||
CSB-CL864015HU1-10ug | Cusabio | 10ug | EUR 376 |
Description: A cloning plasmid for the BCMO1 gene. |
![]() BCMO1 cloning plasmid |
|||
CSB-CL864015HU2-10ug | Cusabio | 10ug | EUR 570 |
Description: A cloning plasmid for the BCMO1 gene. |
![]() BCMO1 Rabbit pAb |
|||
A15848-100ul | Abclonal | 100 ul | EUR 308 |
![]() BCMO1 Rabbit pAb |
|||
A15848-200ul | Abclonal | 200 ul | EUR 459 |
![]() BCMO1 Rabbit pAb |
|||
A15848-20ul | Abclonal | 20 ul | EUR 183 |
![]() BCMO1 Rabbit pAb |
|||
A15848-50ul | Abclonal | 50 ul | EUR 223 |
![]() BCMO1 Polyclonal Antibody |
|||
29452-100ul | SAB | 100ul | EUR 252 |
![]() BCMO1 Polyclonal Antibody |
|||
29452-50ul | SAB | 50ul | EUR 187 |
![]() anti- BCMO1 antibody |
|||
FNab00851 | FN Test | 100µg | EUR 505.25 |
Description: Antibody raised against BCMO1 |
![]() Recombinant Human Heregulin Beta -1 Protein |
|||
PROTQ02297-1 | BosterBio | 50ug | EUR 317 |
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues). |
![]() Amyloid Beta-Peptide (1-40) (human) |
|||
A1124-1 | ApexBio | 1 mg | EUR 189 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
![]() Human Beta-2-Microglobulin (B2M) AssayMax ELISA Kit |
|||
EM5001-1 | AssayPro | 96 Well Plate | EUR 417 |
![]() BCMO1 ORF Vector (Human) (pORF) |
|||
ORF012325 | ABM | 1.0 ug DNA | EUR 354 |
![]() BCMO1 ORF Vector (Human) (pORF) |
|||
ORF012326 | ABM | 1.0 ug DNA | EUR 354 |
![]() Human Tyrosine 3- monooxygenase, TH ELISA KIT |
|||
ELI-04696h | Lifescience Market | 96 Tests | EUR 824 |
![]() Human Kynurenine 3- monooxygenase, KMO ELISA KIT |
|||
ELI-46405h | Lifescience Market | 96 Tests | EUR 824 |
![]() Human Kynurenine 3 monooxygenase(KMO) ELISA kit |
|||
E01K0092-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Kynurenine 3 monooxygenase(KMO) ELISA kit |
|||
E01K0092-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Kynurenine 3 monooxygenase(KMO) ELISA kit |
|||
E01K0092-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
SEH755Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 4731.5 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
![]() Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
SEH755Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 477.3 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
![]() Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
SEH755Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 639 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
![]() Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
SEH755Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 2575.5 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
![]() Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
4-SEH755Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
![]() Human Kynurenine 3-monooxygenase (KMO) ELISA Kit |
|||
abx573591-96tests | Abbexa | 96 tests | EUR 668 |
![]() Human Coenzyme Q6, Monooxygenase (COQ6) ELISA Kit |
|||
abx386638-96tests | Abbexa | 96 tests | EUR 911 |
![]() Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
20-abx152142 | Abbexa |
|
|
![]() Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
DLR-KMO-Hu-48T | DL Develop | 48T | EUR 517 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids. |
![]() Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
DLR-KMO-Hu-96T | DL Develop | 96T | EUR 673 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids. |
![]() ELISA kit for Human Squalene monooxygenase (SQLE) |
|||
KTE60353-48T | Abbkine | 48T | EUR 332 |
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
![]() ELISA kit for Human Squalene monooxygenase (SQLE) |
|||
KTE60353-5platesof96wells | Abbkine | 5 plates of 96 wells | EUR 2115 |
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
![]() ELISA kit for Human Squalene monooxygenase (SQLE) |
|||
KTE60353-96T | Abbkine | 96T | EUR 539 |
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
![]() Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
RD-KMO-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 521 |
![]() Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
RD-KMO-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 723 |
![]() Human TH/ Tyrosine 3-monooxygenase ELISA Kit |
|||
E2487Hu | Sunlong | 1 Kit | EUR 571 |
![]() Human KMO/ Kynurenine 3-monooxygenase ELISA Kit |
|||
E1395Hu | Sunlong | 1 Kit | EUR 605 |
![]() Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
RDR-KMO-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 544 |
![]() Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
RDR-KMO-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 756 |
![]() Human KMO(Kynurenine 3-monooxygenase) ELISA Kit |
|||
EH14776 | FN Test | 96T | EUR 567.6 |
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
![]() Human TH(Tyrosine 3-monooxygenase) ELISA Kit |
|||
EH1602 | FN Test | 96T | EUR 524.1 |
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
![]() Human Deoxyhypusine Hydroxylase/Monooxygenase(DOHH)ELISA Kit |
|||
QY-E01153 | Qayee Biotechnology | 96T | EUR 361 |
![]() Human Kynurenine-3-Monooxygenase(KMO)ELISA Kit |
|||
QY-E01801 | Qayee Biotechnology | 96T | EUR 361 |
![]() PinPoint-FC System for Platform Cell Line Generation & Retargeting (includes PIN300A-1, FC200PA-1, PIN200A-1, PIN510A-1, & PIN600A-1) |
|||
PIN300A-KIT | SBI | 1 Kit | EUR 2798 |
![]() Beta-Amyloid (1-11) |
|||
A1002-1 | ApexBio | 1 mg | EUR 102 |
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein. |
![]() Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit |
|||
E01D0299-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit |
|||
E01D0299-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit |
|||
E01D0299-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1) |
|||
KTE61571-48T | Abbkine | 48T | EUR 332 |
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
![]() ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1) |
|||
KTE61571-5platesof96wells | Abbkine | 5 plates of 96 wells | EUR 2115 |
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
![]() ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1) |
|||
KTE61571-96T | Abbkine | 96T | EUR 539 |
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
![]() PinPoint-HR System for Platform Cell Line Generation & Retargeting (includes PIN400A-1, PIN200A-1, PIN510A-1, & PIN600A-1) |
|||
PIN400A-KIT | SBI | 1 Kit | EUR 2798 |
![]() Human Flavin Containing Monooxygenase 1 (FMO1) CLIA Kit |
|||
20-abx494912 | Abbexa |
|
|
![]() T7 gRNA SmartNuclease Synthesis Kit (includes CAS510A-1 & T7 IVT synthesis reagents) |
|||
CAS510A-KIT | SBI | 1 Kit | EUR 805 |
![]() PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, GE601A-1, PIN200A-1, PIN510A-1, & PIN600A-1) |
|||
PIN410A-KIT | SBI | 1 Kit | EUR 4335 |
![]() PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, CAS601A-1, PIN200A-1, PIN510A-1, & PIN600A-1) |
|||
PIN412A-KIT | SBI | 1 Kit | EUR 4335 |
![]() IL-1-beta Interleukin-1 beta Mouse Recombinant Protein, His Tag |
|||
PROTP10749-1 | BosterBio | Regular: 25ug | EUR 317 |
Description: Interleukin-1 beta Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 189 amino acids and having a molecular mass of 21 kDa. ;The IL-1b is fused to His-Tag and purified by proprietary chromatographic techniques. |
![]() Human SIRP BETA 1 (SIRP BETA 1) ELISA Kit |
|||
abx259843-96tests | Abbexa | 96 tests | EUR 911 |
![]() ITGB1 Human, Integrin Beta 1 Human Recombinant Protein, Sf9 |
|||
PROTP05556-1 | BosterBio | Regular: 10ug | EUR 317 |
Description: ITGB1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 716 amino acids (1-728) and having a molecular mass of 79.4kDa (Molecular size on SDS-PAGE will appear at approximately 70-100kDa). ITGB1 is fused to an 8 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques.  |
![]() TGF-b-1 Transforming Growth Factor-beta 1 Human protein |
|||
PROTP01137-1 | BosterBio | Regular: 2.5ug | EUR 1157 |
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques. |
![]() BCMO1 Recombinant Protein (Rat) |
|||
RP192062 | ABM | 100 ug | Ask for price |
![]() BCMO1 Recombinant Protein (Mouse) |
|||
RP119363 | ABM | 100 ug | Ask for price |
![]() BCMO1 Recombinant Protein (Mouse) |
|||
RP119366 | ABM | 100 ug | Ask for price |
![]() Mouse BCMO1 shRNA Plasmid |
|||
20-abx975231 | Abbexa |
|
|
![]() BCMO1 Polyclonal Conjugated Antibody |
|||
C29452 | SAB | 100ul | EUR 397 |
![]() IL-1 beta, rat recombinant |
|||
P1019-1 | ApexBio | 1 mg | EUR 7288 |
Description: Interleukin 1 beta (IL-1?) is a proinflammatory cytokine and is produced by activated macrophages, monocytes, keratinocytes and other epithelial cells. Both IL-1? and IL-1? bind to the same receptor and have similar biological properties. |
![]() Mouse Alkylglycerol monooxygenase, Agmo ELISA KIT |
|||
ELI-24173m | Lifescience Market | 96 Tests | EUR 865 |
![]() Mouse Squalene monooxygenase, Sqle ELISA KIT |
|||
ELI-26561m | Lifescience Market | 96 Tests | EUR 865 |
![]() Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E02A2009-192T | BlueGene | 192 tests | EUR 1270 |
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E02A2009-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E02A2009-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E03A2009-192T | BlueGene | 192 tests | EUR 1270 |
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E03A2009-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E03A2009-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E04A2009-192T | BlueGene | 192 tests | EUR 1270 |
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E04A2009-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E04A2009-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E09A2009-192T | BlueGene | 192 tests | EUR 1270 |
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E09A2009-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E09A2009-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E07A2009-192T | BlueGene | 192 tests | EUR 1270 |
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E07A2009-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E07A2009-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E08A2009-192T | BlueGene | 192 tests | EUR 1270 |
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E08A2009-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E08A2009-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E06A2009-192T | BlueGene | 192 tests | EUR 1270 |
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E06A2009-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E06A2009-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Rat Squalene monooxygenase (SQLE) ELISA Kit |
|||
abx392005-96tests | Abbexa | 96 tests | EUR 911 |
![]() Mouse Squalene monooxygenase (SQLE) ELISA Kit |
|||
abx390641-96tests | Abbexa | 96 tests | EUR 911 |
![]() Tyrosine 3-monooxygenase (TH) ELISA Kit |
|||
20-abx258488 | Abbexa |
|
|
![]() Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit |
|||
GA-E0825RT-48T | GenAsia Biotech | 48T | EUR 317 |
![]() Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit |
|||
GA-E0825RT-96T | GenAsia Biotech | 96T | EUR 496 |
![]() Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit |
|||
QY-E10827 | Qayee Biotechnology | 96T | EUR 361 |
![]() Mouse Alkylglycerol Monooxygenase(AGMO)ELISA Kit |
|||
QY-E20067 | Qayee Biotechnology | 96T | EUR 361 |
![]() YWHAE Tyr-3/Trp- 5 Monooxygenase Activation Protein Epsilon Human Recombinant Protein |
|||
PROTP62258-1 | BosterBio | Regular: 20ug | EUR 317 |
Description: YWHAE Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 255 amino acids (1-255) and having a molecular mass of 29 kDa. ;YWHAE is purified by proprietary chromatographic techniques. |
![]() Luciferase Firefly, Luciferin 4-Monooxygenase Firefly Recombinant Protein, Active |
|||
PROTP08659-1 | BosterBio | Regular: 5ug | EUR 317 |
Description: Luciferase produced in E.Coli is a single, non-glycosylated polypeptide chain containing 335 amino acids (1-311 a.a) and having a molecular mass of 38.5kDa.; Luciferase is fused to a 24 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques. |
![]() PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9 |
|||
PROTP11464-1 | BosterBio | Regular: 10ug | EUR 317 |
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques. |
![]() AXYPET STARTER KIT 1 AP-20, AP-200 & AP-1000 WITH ADDITIONAL FREE RACKS OF AXYGEN PIPETTE TIPS |
|||
AP-STR-KIT-1 | CORNING | 1/pk | EUR 355 |
Description: Corning and Axygen Liquid Handling Equipment; Axypet Pipettors and Motopet Pipet Controller |
![]() Bcmo1 sgRNA CRISPR Lentivector (Rat) (Target 1) |
|||
K7529202 | ABM | 1.0 ug DNA | EUR 154 |
![]() Bcmo1 sgRNA CRISPR Lentivector (Mouse) (Target 1) |
|||
K3981802 | ABM | 1.0 ug DNA | EUR 154 |
![]() Chicken DBH- like monooxygenase protein 1, MOXD1 ELISA KIT |
|||
ELI-14227c | Lifescience Market | 96 Tests | EUR 928 |
![]() Mouse DBH- like monooxygenase protein 1, Moxd1 ELISA KIT |
|||
ELI-38586m | Lifescience Market | 96 Tests | EUR 865 |
![]() BCMO1 sgRNA CRISPR Lentivector set (Human) |
|||
K0177301 | ABM | 3 x 1.0 ug | EUR 339 |
![]() Human Ubiquinone biosynthesis monooxygenase COQ6, COQ6 ELISA KIT |
|||
ELI-09305h | Lifescience Market | 96 Tests | EUR 824 |
![]() Human Cholesterol 7- alpha- monooxygenase, CYP7A1 ELISA KIT |
|||
ELI-03412h | Lifescience Market | 96 Tests | EUR 824 |
![]() Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
SEC744Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 4731.5 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids. |
![]() Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
SEC744Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 477.3 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids. |
![]() Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
SEC744Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 639 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids. |
![]() Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
SEC744Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 2575.5 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids. |
![]() Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
4-SEC744Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
![]() Human Flavin Containing Monooxygenase 2 (FMO2) ELISA Kit |
|||
abx387386-96tests | Abbexa | 96 tests | EUR 911 |
![]() Human Flavin Containing Monooxygenase 5 (FMO5) ELISA Kit |
|||
abx387387-96tests | Abbexa | 96 tests | EUR 911 |
![]() Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
20-abx152632 | Abbexa |
|
|
![]() Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
DLR-PAM-Hu-48T | DL Develop | 48T | EUR 517 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates or other biological fluids. |
![]() Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
DLR-PAM-Hu-96T | DL Develop | 96T | EUR 673 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates or other biological fluids. |
![]() Human Peptidylglycine Alpha Amidating Monooxygenase ELISA Kit (PAM) |
|||
RK02013 | Abclonal | 96 Tests | EUR 521 |
![]() Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
RD-PAM-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 521 |
![]() Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
RD-PAM-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 723 |
![]() ELISA kit for Human KMO (Kynurenine-3-Monooxygenase) |
|||
ELK4176 | ELK Biotech | 1 plate of 96 wells | EUR 432 |
Description: A sandwich ELISA kit for detection of Kynurenine-3-Monooxygenase from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
![]() Human CYP7A1/ Cholesterol 7-alpha-monooxygenase ELISA Kit |
|||
E0651Hu | Sunlong | 1 Kit | EUR 571 |
![]() Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
RDR-PAM-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 544 |
![]() Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
RDR-PAM-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 756 |
![]() ELISA kit for Human Cholesterol 7-alpha-monooxygenase |
|||
EK2656 | SAB | 96 tests | EUR 553 |
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Cholesterol 7-alpha-monooxygenase in samples from serum, plasma, tissue homogenates and other biological fluids. |
![]() Human CYP7A1(Cholesterol 7-alpha-monooxygenase) ELISA Kit |
|||
EH1191 | FN Test | 96T | EUR 524.1 |
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
![]() Sqle ELISA Kit| Rat Squalene monooxygenase ELISA Kit |
|||
EF019365 | Lifescience Market | 96 Tests | EUR 689 |
![]() Sqle ELISA Kit| Mouse Squalene monooxygenase ELISA Kit |
|||
EF016284 | Lifescience Market | 96 Tests | EUR 689 |
![]() Frit Kit |
|||
FRIT-KIT | Next Advance | 1each | EUR 124 |
Description: Kit to create frits in capillaries. Includes formamide, Kasil-1, Kasil-1624 and a cleaving tool. |
![]() TPSAB1 Human, Tryptase Alpha/Beta 1 Human Recombinant Protein, Sf9 |
|||
PROTQ15661-1 | BosterBio | Regular: 10ug | EUR 317 |
Description: TPSAB1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (31-275 a.a.) and fused to a 6 aa His Tag at C-terminus containing a total of 251 amino acids and having a molecular mass of 28.2kDa.TPSAB1 shows multiple bands between 28-40kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.  |
![]() ATP1B1 Human, ATPase Transporting Beta 1 Human Recombinant Protein, Sf9 |
|||
PROTP05026-1 | BosterBio | Regular: 10ug | EUR 317 |
Description: ATP1B1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 250 amino acids (63-303 a.a.) and having a molecular mass of 29kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa).;ATP1B1 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques. |
![]() ATP1B2 Human, ATPase Transporting Beta 1 Human Recombinant Protein, Sf9 |
|||
PROTP14415-1 | BosterBio | Regular: 10ug | EUR 317 |
Description: ATP1B2 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 232 amino acids (68-290a.a.) and having a molecular mass of 26.4kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa). ATP1B2 is expressed with a 9 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques. |
![]() ER beta-1 (Estrogen Receptor beta-1); Clone ERb455 (Concentrate) |
|||
RA0111-C.1 | ScyTek Laboratories | 0.1 ml | EUR 125 |
![]() Methylsterol monooxygenase 1 (MSMO1) Antibody |
|||
20-abx339329 | Abbexa |
|
|
![]() Methylsterol monooxygenase 1 (MSMO1) Antibody |
|||
20-abx211004 | Abbexa |
|
|
![]() Methylsterol Monooxygenase 1 (ERG25) Antibody |
|||
abx027706-400ul | Abbexa | 400 ul | EUR 523 |
![]() Methylsterol Monooxygenase 1 (ERG25) Antibody |
|||
abx027706-80l | Abbexa | 80 µl | EUR 286 |
![]() flavin containing monooxygenase 1 antibody |
|||
22997-100ul | SAB | 100ul | EUR 390 |