Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

To Order Contact us: 

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    RDR-bCMO1-Hu-48Tests 48 Tests
    EUR 652.8

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    RDR-bCMO1-Hu-96Tests 96 Tests
    EUR 907.2

    Beta-Carotene-15,15-Monooxygenase 1 (bCMO1) Antibody

    20-abx171410
    • EUR 1028.40
    • EUR 526.80
    • 1 mg
    • 200 ug

    beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

    abx122471-100ug 100 ug
    EUR 469.2

    Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Antibody

    20-abx130708
    • EUR 376.80
    • EUR 159.60
    • EUR 978.00
    • EUR 510.00
    • EUR 326.40
    • 100 ug
    • 10 ug
    • 1 mg
    • 200 ug
    • 50 ug

    beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

    abx025732-400ul 400 ul
    EUR 627.6

    beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

    abx025732-80l 80 µl
    EUR 343.2

    beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

    abx230851-100ug 100 ug
    EUR 577.2

    Recombinant Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1)

    4-RPE246Hu01
    • EUR 582.34
    • EUR 279.60
    • EUR 1853.76
    • EUR 697.92
    • EUR 1275.84
    • EUR 465.60
    • EUR 4454.40
    • 100 ug
    • 10ug
    • 1 mg
    • 200 ug
    • 500 ug
    • 50ug
    • 5 mg
    Description: Recombinant Human Beta-Carotene-15,15'-Monooxygenase 1 expressed in: E.coli

    Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    20-abx150797
    • EUR 8853.60
    • EUR 4719.60
    • EUR 1093.20
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    SEE246Hu-10x96wellstestplate 10x96-wells test plate
    EUR 5677.8
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    SEE246Hu-1x48wellstestplate 1x48-wells test plate
    EUR 572.76
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    SEE246Hu-1x96wellstestplate 1x96-wells test plate
    EUR 766.8
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    SEE246Hu-5x96wellstestplate 5x96-wells test plate
    EUR 3090.6
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

    Human Beta,beta- carotene 15,15'- monooxygenase, BCMO1 ELISA KIT

    ELI-10937h 96 Tests
    EUR 988.8

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Protein

    20-abx650585
    • EUR 811.20
    • EUR 343.20
    • EUR 2498.40
    • EUR 961.20
    • EUR 577.20
    • 100 ug
    • 10 ug
    • 1 mg
    • 200 ug
    • 50 ug

    Mouse Beta,beta- carotene 15,15'- monooxygenase, Bcmo1 ELISA KIT

    ELI-11036m 96 Tests
    EUR 1038

    Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) CLIA Kit

    20-abx494551
    • EUR 9567.60
    • EUR 5095.20
    • EUR 1177.20
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    ELISA kit for Human bCMO1 (Beta-Carotene-15,15'-Monooxygenase 1)

    ELK4791 1 plate of 96 wells
    EUR 518.4
    Description: A sandwich ELISA kit for detection of Beta-Carotene-15,15'-Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

    Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) ELISA Kit

    4-SEE246Hu
    • EUR 5738.40
    • EUR 3031.20
    • EUR 768.00
    • 10 plates of 96 wells
    • 5 plates of 96 wells
    • 1 plate of 96 wells
    Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human)

    4-PAE246Hu01
    • EUR 296.40
    • EUR 3012.00
    • EUR 750.00
    • EUR 372.00
    • EUR 256.80
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1)

    Human Beta,beta-carotene 15,15'-dioxygenase (BCO1) ELISA Kit

    abx392200-96tests 96 tests
    EUR 1093.2

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC

    4-PAE246Hu01-APC
    • EUR 414.00
    • EUR 3930.00
    • EUR 1094.40
    • EUR 528.00
    • EUR 262.80
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC.

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Biotinylated

    4-PAE246Hu01-Biotin
    • EUR 373.20
    • EUR 2952.00
    • EUR 872.40
    • EUR 457.20
    • EUR 262.80
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Biotin.

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Cy3

    4-PAE246Hu01-Cy3
    • EUR 502.80
    • EUR 5190.00
    • EUR 1410.00
    • EUR 654.00
    • EUR 301.20
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Cy3.

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), FITC

    4-PAE246Hu01-FITC
    • EUR 355.20
    • EUR 3168.00
    • EUR 900.00
    • EUR 446.40
    • EUR 234.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with FITC.

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), HRP

    4-PAE246Hu01-HRP
    • EUR 379.20
    • EUR 3426.00
    • EUR 968.40
    • EUR 477.60
    • EUR 247.20
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with HRP.

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), PE

    4-PAE246Hu01-PE
    • EUR 355.20
    • EUR 3168.00
    • EUR 900.00
    • EUR 446.40
    • EUR 234.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with PE.

    Rat Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit

    abx391017-96tests 96 tests
    EUR 1093.2

    Mouse Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit

    abx388677-96tests 96 tests
    EUR 1093.2

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC-Cy7

    4-PAE246Hu01-APC-Cy7
    • EUR 685.20
    • EUR 7716.00
    • EUR 2046.00
    • EUR 912.00
    • EUR 382.80
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC-Cy7.

    Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody

    20-abx310811
    • EUR 493.20
    • EUR 2214.00
    • EUR 718.80
    • EUR 218.40
    • EUR 360.00
    • 100 ug
    • 1 mg
    • 200 ug
    • 20 ug
    • 50 ug

    Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (HRP)

    20-abx310812
    • EUR 493.20
    • EUR 2214.00
    • EUR 718.80
    • EUR 218.40
    • EUR 360.00
    • 100 ug
    • 1 mg
    • 200 ug
    • 20 ug
    • 50 ug

    Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (FITC)

    20-abx310813
    • EUR 493.20
    • EUR 2214.00
    • EUR 718.80
    • EUR 218.40
    • EUR 360.00
    • 100 ug
    • 1 mg
    • 200 ug
    • 20 ug
    • 50 ug

    Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (Biotin)

    20-abx310814
    • EUR 493.20
    • EUR 2214.00
    • EUR 718.80
    • EUR 218.40
    • EUR 360.00
    • 100 ug
    • 1 mg
    • 200 ug
    • 20 ug
    • 50 ug

    Human beta carotene

    QY-E05643 96T
    EUR 433.2

    beta-Carotene

    GP8334-10G 10 g
    EUR 122.4

    beta-Carotene

    GP8334-1G 1 g
    EUR 57.6

    beta-Carotene

    GP8334-25G 25 g
    EUR 208.8

    beta-Carotene

    GP8334-5G 5 g
    EUR 88.8

    Beta-Carotene

    TB0299 8XX100mg
    EUR 328.8

    Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed

    ELISA-1 1
    EUR 242.4

    Bcmo1/ Rat Bcmo1 ELISA Kit

    ELI-33406r 96 Tests
    EUR 1063.2

    Human Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

    abx250481-96tests 96 tests
    EUR 801.6

    Human BCO2(Beta,beta-carotene 9',10'-oxygenase) ELISA Kit

    EH1224 96T
    EUR 681.12
    Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.469 ng/ml

    ELISA kit for Human Beta,beta-carotene 9',10'-oxygenase

    EK2713 96 tests
    EUR 663.6
    Description: Enzyme-linked immunosorbent assay kit for quantification of Human Beta,beta-carotene 9',10'-oxygenase in samples from serum, plasma, tissue homogenates and other biological fluids.

    Human Beta,beta- carotene 9',10'- oxygenase, BCO2 ELISA KIT

    ELI-49386h 96 Tests
    EUR 988.8

    Human BCO2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit

    E0265Hu 1 Kit
    EUR 726

    Mouse Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

    abx515122-96tests 96 tests
    EUR 886.8

    Mouse Bco2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit

    E0170Mo 1 Kit
    EUR 758.4

    Mouse Beta,beta- carotene 9',10'- oxygenase, Bco2 ELISA KIT

    ELI-49387m 96 Tests
    EUR 1038

    Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

    EI2200-1 96 Well Plate
    EUR 572.4

    BCMO1 ELISA Kit (Human) (OKCD04382)

    OKCD04382 96 Wells
    EUR 997.2
    Description: Description of target: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich ELISA;Sensitivity: 0.49 ng/mL

    Human TGF-beta-1 AssayMax ELISA Kit

    ET3102-1 96 Well Plate
    EUR 572.4

    Chicken BCMO1 ELISA KIT

    ELI-25375c 96 Tests
    EUR 1113.6

    Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

    EMI2200-1 96 Well Plate
    EUR 572.4

    Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

    20-abx003844
    • EUR 493.20
    • EUR 710.40
    • EUR 218.40
    • EUR 376.80
    • 100 ul
    • 200 ul
    • 20 ul
    • 50 ul

    Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

    abx122472-100ug 100 ug
    EUR 469.2

    Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

    abx230852-100ug 100 ug
    EUR 577.2

    YWHAB Tyr-3/Trp- 5 Monooxygenase Activation Protein Beta Human Recombinant Protein

    PROTP31946-1 Regular: 25ug
    EUR 380.4
    Description: YWHAB Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and having a molecular mass of 28kDa. ;YWHAB is purified by proprietary chromatographic techniques.

    β-Carotene

    HY-N0411 50mg
    EUR 129.6

    alpha-Carotene

    TBZ2607 5mg Ask for price

    Human Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

    abx385151-96tests 96 tests
    EUR 1093.2

    Human Methylsterol monooxygenase 1, MSMO1 ELISA KIT

    ELI-23191h 96 Tests
    EUR 988.8

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    20-abx151570
    • EUR 8853.60
    • EUR 4719.60
    • EUR 1093.20
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    Human Monooxygenase DBH Like 1 (MOXD1) ELISA Kit

    abx381498-96tests 96 tests
    EUR 1093.2

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    DLR-FMO1-Hu-48T 48T
    EUR 620.4
    Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    DLR-FMO1-Hu-96T 96T
    EUR 807.6
    Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    SEF458Hu-10x96wellstestplate 10x96-wells test plate
    EUR 5677.8
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    SEF458Hu-1x48wellstestplate 1x48-wells test plate
    EUR 572.76
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    SEF458Hu-1x96wellstestplate 1x96-wells test plate
    EUR 766.8
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    SEF458Hu-5x96wellstestplate 5x96-wells test plate
    EUR 3090.6
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    4-SEF458Hu
    • EUR 5738.40
    • EUR 3031.20
    • EUR 768.00
    • 10 plates of 96 wells
    • 5 plates of 96 wells
    • 1 plate of 96 wells
    Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    RDR-FMO1-Hu-48Tests 48 Tests
    EUR 652.8

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    RDR-FMO1-Hu-96Tests 96 Tests
    EUR 907.2

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    RD-FMO1-Hu-48Tests 48 Tests
    EUR 625.2

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    RD-FMO1-Hu-96Tests 96 Tests
    EUR 867.6

    ExoAb Antibody Kit (CD9, CD63, CD81, Hsp70 antibodies, rabbit anti-human) with goat anti-rabbit HRP secondary antibody

    EXOAB-KIT-1 25 ul each
    EUR 752.4

    BCMO1 siRNA

    20-abx909008
    • EUR 661.20
    • EUR 878.40
    • 15 nmol
    • 30 nmol

    BCMO1 siRNA

    20-abx909009
    • EUR 661.20
    • EUR 878.40
    • 15 nmol
    • 30 nmol

    mRNAExpress mRNA Synthesis kit (5 reactions)

    MR-KIT-1 5 reactions
    EUR 1382.4

    Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit

    201-12-2419 96 tests
    EUR 528
    Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

    Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E01A2009-192T 192 tests
    EUR 1524
    Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E01A2009-48 1 plate of 48 wells
    EUR 624
    Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E01A2009-96 1 plate of 96 wells
    EUR 822
    Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human SQLE/ Squalene monooxygenase ELISA Kit

    E2385Hu 1 Kit
    EUR 726

    Kynurenine 3-monooxygenase ELISA Kit|Human

    EF005180 96 Tests
    EUR 826.8

    Human Alkylglycerol monooxygenase, AGMO ELISA KIT

    ELI-24195h 96 Tests
    EUR 988.8

    Human Squalene monooxygenase, SQLE ELISA KIT

    ELI-32784h 96 Tests
    EUR 988.8

    Human Alkylglycerol Monooxygenase(AGMO)ELISA Kit

    QY-E01119 96T
    EUR 433.2

    Human Beta-2-Microglobulin (B2M) AssayMax ELISA Kit

    EM5001-1 96 Well Plate
    EUR 500.4

    PinPoint-FC 293T Platform Kit for Targeted Gene Insertion (includes PIN320A-1, PIN200A-1, PIN510A-1 & PIN600A-1)

    PIN320A-KIT 1 Kit
    EUR 5929.2

    Rat Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

    abx391608-96tests 96 tests
    EUR 1093.2

    Mouse Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

    abx389876-96tests 96 tests
    EUR 1093.2

    Chicken Methylsterol monooxygenase 1, MSMO1 ELISA KIT

    ELI-23404c 96 Tests
    EUR 1113.6

    Mouse Methylsterol monooxygenase 1, Msmo1 ELISA KIT

    ELI-45646m 96 Tests
    EUR 1038

    Porcine Methylsterol monooxygenase 1, MSMO1 ELISA KIT

    ELI-42078p 96 Tests
    EUR 1113.6

    PinPoint-FC Murine iPSC Platform Kit for Targeted Gene Insertion (includes PIN340iPS-1, PIN200A-1, PIN510A-1 & PIN600A-1)

    PIN340iPS-KIT 1 Kit
    EUR 5929.2

    Human BCMO1 shRNA Plasmid

    20-abx959976
    • EUR 961.20
    • EUR 1345.20
    • 150 µg
    • 300 µg

    BCMO1 Recombinant Protein (Human)

    RP036973 100 ug Ask for price

    BCMO1 Recombinant Protein (Human)

    RP036976 100 ug Ask for price

    Msmo1 ELISA Kit| Mouse Methylsterol monooxygenase 1 ELISA Kit

    EF015513 96 Tests
    EUR 826.8

    MSMO1 ELISA Kit| chicken Methylsterol monooxygenase 1 ELISA Kit

    EF012392 96 Tests
    EUR 826.8

    Msmo1 ELISA Kit| Rat Methylsterol monooxygenase 1 ELISA Kit

    EF018966 96 Tests
    EUR 826.8

    ELISA kit for Human FMO1 (Flavin Containing Monooxygenase 1)

    ELK4594 1 plate of 96 wells
    EUR 518.4
    Description: A sandwich ELISA kit for detection of Flavin Containing Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

    Human DBH- like monooxygenase protein 1, MOXD1 ELISA KIT

    ELI-43781h 96 Tests
    EUR 988.8

    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

    abx332554-100ul 100 ul
    EUR 510

    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

    20-abx329250
    • EUR 376.80
    • EUR 292.80
    • 100 ug
    • 50 ug

    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

    20-abx241015
    • EUR 493.20
    • EUR 360.00
    • 100 ul
    • 50 ul

    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

    20-abx241094
    • EUR 493.20
    • EUR 360.00
    • 100 ul
    • 50 ul

    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

    20-abx214774
    • EUR 493.20
    • EUR 360.00
    • 100 ul
    • 50 ul

    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

    20-abx214826
    • EUR 493.20
    • EUR 360.00
    • 100 ul
    • 50 ul

    Amyloid Beta-Peptide (1-40) (human)

    A1124-1 1 mg
    EUR 226.8
    Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

    Recombinant Human Heregulin Beta -1 Protein

    PROTQ02297-1 50ug
    EUR 380.4
    Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues).

    Rat Kynurenine 3-monooxygenase(KMO) ELISA kit

    1-CSB-EL012475RA
    • EUR 964.80
    • EUR 6118.80
    • EUR 3244.80
    • 1 plate of 96 wells
    • 10 plates of 96 wells each
    • 5 plates of 96 wells each
    Description: Quantitativesandwich ELISA kit for measuring Rat Kynurenine 3-monooxygenase(KMO) in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

    Human Genomic DNA 

    X11000
    • Ask for price
    • EUR 235.40
    • 0.2 ml
    • 0.2 ml

    BCMO1 sgRNA CRISPR Lentivector (Human) (Target 1)

    K0177302 1.0 ug DNA
    EUR 184.8

    Human Brain Genomic DNA  

    X11001
    • Ask for price
    • EUR 77.00
    • 10 µg
    • 10 ul

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    20-abx152142
    • EUR 8853.60
    • EUR 4719.60
    • EUR 1093.20
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    Human Kynurenine 3-monooxygenase (KMO) ELISA Kit

    abx573591-96tests 96 tests
    EUR 801.6

    Human Coenzyme Q6, Monooxygenase (COQ6) ELISA Kit

    abx386638-96tests 96 tests
    EUR 1093.2

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    DLR-KMO-Hu-48T 48T
    EUR 620.4
    Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    DLR-KMO-Hu-96T 96T
    EUR 807.6
    Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids.

    Human Kynurenine 3 monooxygenase(KMO) ELISA kit

    E01K0092-192T 192 tests
    EUR 1524
    Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Kynurenine 3 monooxygenase(KMO) ELISA kit

    E01K0092-48 1 plate of 48 wells
    EUR 624
    Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Kynurenine 3 monooxygenase(KMO) ELISA kit

    E01K0092-96 1 plate of 96 wells
    EUR 822
    Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human KMO(Kynurenine 3-monooxygenase) ELISA Kit

    EH14776 96T
    EUR 681.12
    Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

    Human TH(Tyrosine 3-monooxygenase) ELISA Kit

    EH1602 96T
    EUR 628.92
    Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

    Human KMO/ Kynurenine 3-monooxygenase ELISA Kit

    E1395Hu 1 Kit
    EUR 726

    Human TH/ Tyrosine 3-monooxygenase ELISA Kit

    E2487Hu 1 Kit
    EUR 685.2

    Human Kynurenine 3- monooxygenase, KMO ELISA KIT

    ELI-46405h 96 Tests
    EUR 988.8

    ELISA kit for Human Squalene monooxygenase (SQLE)

    KTE60353-48T 48T
    EUR 398.4
    Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

    ELISA kit for Human Squalene monooxygenase (SQLE)

    KTE60353-5platesof96wells 5 plates of 96 wells
    EUR 2538
    Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

    ELISA kit for Human Squalene monooxygenase (SQLE)

    KTE60353-96T 96T
    EUR 646.8
    Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

    Human Tyrosine 3- monooxygenase, TH ELISA KIT

    ELI-04696h 96 Tests
    EUR 988.8

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    SEH755Hu-10x96wellstestplate 10x96-wells test plate
    EUR 5677.8
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    SEH755Hu-1x48wellstestplate 1x48-wells test plate
    EUR 572.76
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    SEH755Hu-1x96wellstestplate 1x96-wells test plate
    EUR 766.8
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    SEH755Hu-5x96wellstestplate 5x96-wells test plate
    EUR 3090.6
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    4-SEH755Hu
    • EUR 5738.40
    • EUR 3031.20
    • EUR 768.00
    • 10 plates of 96 wells
    • 5 plates of 96 wells
    • 1 plate of 96 wells
    Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    RDR-KMO-Hu-48Tests 48 Tests
    EUR 652.8

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    RDR-KMO-Hu-96Tests 96 Tests
    EUR 907.2

    Human Deoxyhypusine Hydroxylase/Monooxygenase(DOHH)ELISA Kit

    QY-E01153 96T
    EUR 433.2

    Human Kynurenine-3-Monooxygenase(KMO)ELISA Kit

    QY-E01801 96T
    EUR 433.2

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    RD-KMO-Hu-48Tests 48 Tests
    EUR 625.2

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    RD-KMO-Hu-96Tests 96 Tests
    EUR 867.6

    Beta-Amyloid (1-11)

    A1002-1 1 mg
    EUR 122.4
    Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein.

    BCMO1 Polyclonal Antibody

    29452-100ul 100ul
    EUR 302.4

    BCMO1 Polyclonal Antibody

    29452-50ul 50ul
    EUR 224.4

    BCMO1 Rabbit pAb

    A15848-100ul 100 ul
    EUR 369.6

    BCMO1 Rabbit pAb

    A15848-200ul 200 ul
    EUR 550.8

    BCMO1 Rabbit pAb

    A15848-20ul 20 ul
    EUR 219.6

    BCMO1 Rabbit pAb

    A15848-50ul 50 ul
    EUR 267.6

    BCMO1 cloning plasmid

    CSB-CL864015HU1-10ug 10ug
    EUR 451.2
    Description: A cloning plasmid for the BCMO1 gene.

    BCMO1 cloning plasmid

    CSB-CL864015HU2-10ug 10ug
    EUR 684
    Description: A cloning plasmid for the BCMO1 gene.

    Anti-BCMO1 antibody

    PAab00851 100 ug
    EUR 426

    anti- BCMO1 antibody

    FNab00851 100µg
    EUR 606.3
    Description: Antibody raised against BCMO1

    BCMO1 Polyclonal Antibody

    A72807-050 50 ul
    EUR 302.5

    BCMO1 Polyclonal Antibody

    A72807-100 100 ul
    EUR 423.5

    BCMO1 Polyclonal Antibody

    A72807
    • EUR 302.50
    • EUR 423.50
    • 50 ul
    • 100 ul

    Human Lithostathine-1-beta(REG1B) ELISA kit

    1-CSB-EL019547HU
    • EUR 964.80
    • EUR 6118.80
    • EUR 3244.80
    • 1 plate of 96 wells
    • 10 plates of 96 wells each
    • 5 plates of 96 wells each
    Description: Quantitativesandwich ELISA kit for measuring Human Lithostathine-1-beta(REG1B) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

    Human Integrin beta-1(ITGB1) ELISA kit

    1-CSB-EL011880HU
    • EUR 964.80
    • EUR 6118.80
    • EUR 3244.80
    • 1 plate of 96 wells
    • 10 plates of 96 wells each
    • 5 plates of 96 wells each
    Description: Quantitativesandwich ELISA kit for measuring Human Integrin beta-1(ITGB1) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

    T7 gRNA SmartNuclease Synthesis Kit (includes CAS510A-1 & T7 IVT synthesis reagents)

    CAS510A-KIT 1 Kit
    EUR 966

    PinPoint-FC System for Platform Cell Line Generation & Retargeting (includes PIN300A-1, FC200PA-1, PIN200A-1, PIN510A-1, & PIN600A-1)

    PIN300A-KIT 1 Kit
    EUR 3357.6

    Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit

    E01D0299-192T 192 tests
    EUR 1524
    Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit

    E01D0299-48 1 plate of 48 wells
    EUR 624
    Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit

    E01D0299-96 1 plate of 96 wells
    EUR 822
    Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1)

    KTE61571-48T 48T
    EUR 398.4
    Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

    ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1)

    KTE61571-5platesof96wells 5 plates of 96 wells
    EUR 2538
    Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

    ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1)

    KTE61571-96T 96T
    EUR 646.8
    Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

    PinPoint-HR System for Platform Cell Line Generation & Retargeting (includes PIN400A-1, PIN200A-1, PIN510A-1, & PIN600A-1)

    PIN400A-KIT 1 Kit
    EUR 3357.6

    IL-1-beta Interleukin-1 beta Mouse Recombinant Protein, His Tag

    PROTP10749-1 Regular: 25ug
    EUR 380.4
    Description: Interleukin-1 beta Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 189 amino acids and having a molecular mass of 21 kDa. ;The IL-1b is fused to His-Tag and purified by proprietary chromatographic techniques.

    BCMO1 ORF Vector (Human) (pORF)

    ORF012325 1.0 ug DNA
    EUR 424.8

    BCMO1 ORF Vector (Human) (pORF)

    ORF012326 1.0 ug DNA
    EUR 424.8

    Mouse Cholesterol 7-alpha-monooxygenase(CYP7A1) ELISA kit

    1-CSB-EL006460MO
    • EUR 843.60
    • EUR 5811.60
    • EUR 3084.00
    • 1 plate of 96 wells
    • 10 plates of 96 wells each
    • 5 plates of 96 wells each
    Description: Quantitativesandwich ELISA kit for measuring Mouse Cholesterol 7-alpha-monooxygenase(CYP7A1) in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

    PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, GE601A-1, PIN200A-1, PIN510A-1, & PIN600A-1)

    PIN410A-KIT 1 Kit
    EUR 5202

    PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, CAS601A-1, PIN200A-1, PIN510A-1, & PIN600A-1)

    PIN412A-KIT 1 Kit
    EUR 5202

    Human Kynurenine 3-monooxygenase (KMO)

    1-CSB-EP012475HU
    • EUR 456.00
    • EUR 256.80
    • EUR 1570.80
    • EUR 672.00
    • EUR 1047.60
    • EUR 314.40
    • 100ug
    • 10ug
    • 1MG
    • 200ug
    • 500ug
    • 50ug
    Description: Recombinant Human Kynurenine 3-monooxygenase(KMO) expressed in E.coli

    Human Kynurenine 3-monooxygenase (KMO)

    1-CSB-EP012475HUa0
    • EUR 456.00
    • EUR 256.80
    • EUR 1570.80
    • EUR 672.00
    • EUR 1047.60
    • EUR 314.40
    • 100ug
    • 10ug
    • 1MG
    • 200ug
    • 500ug
    • 50ug
    Description: Recombinant Human Kynurenine 3-monooxygenase(KMO) expressed in E.coli

    Human Kynurenine 3-monooxygenase (KMO)

    1-CSB-EP012475HUb0
    • EUR 456.00
    • EUR 256.80
    • EUR 1570.80
    • EUR 672.00
    • EUR 1047.60
    • EUR 314.40
    • 100ug
    • 10ug
    • 1MG
    • 200ug
    • 500ug
    • 50ug
    Description: Recombinant Human Kynurenine 3-monooxygenase(KMO) expressed in E.coli

    Human Kynurenine 3-monooxygenase (KMO)

    1-CSB-YP012475HU
    • EUR 516.00
    • EUR 280.80
    • EUR 1809.60
    • EUR 770.40
    • EUR 1210.80
    • EUR 349.20
    • 100ug
    • 10ug
    • 1MG
    • 200ug
    • 500ug
    • 50ug
    Description: Recombinant Human Kynurenine 3-monooxygenase(KMO) expressed in Yeast

    Human Flavin Containing Monooxygenase 1 (FMO1) CLIA Kit

    20-abx494912
    • EUR 9567.60
    • EUR 5095.20
    • EUR 1177.20
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    Human SIRP BETA 1 (SIRP BETA 1) ELISA Kit

    abx259843-96tests 96 tests
    EUR 1093.2

    ITGB1 Human, Integrin Beta 1 Human Recombinant Protein, Sf9

    PROTP05556-1 Regular: 10ug
    EUR 380.4
    Description: ITGB1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 716 amino acids (1-728) and having a molecular mass of 79.4kDa (Molecular size on SDS-PAGE will appear at approximately 70-100kDa). ITGB1 is fused to an 8 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques. 

    AXYPET STARTER KIT 1 AP-20, AP-200 & AP-1000 WITH ADDITIONAL FREE RACKS OF AXYGEN PIPETTE TIPS

    AP-STR-KIT-1 1/pk
    EUR 426
    Description: Corning and Axygen Liquid Handling Equipment; Axypet Pipettors and Motopet Pipet Controller

    Human Beta-1, 4-galactosyltransferase 1(B4GALT1) ELISA kit

    1-CSB-EL002513HU
    • EUR 843.60
    • EUR 5811.60
    • EUR 3084.00
    • 1 plate of 96 wells
    • 10 plates of 96 wells each
    • 5 plates of 96 wells each
    Description: Quantitativesandwich ELISA kit for measuring Human Beta-1, 4-galactosyltransferase 1(B4GALT1) in samples from serum, plasma, cell lysates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

    Frit Kit

    FRIT-KIT 1each
    EUR 148.8
    Description: Kit to create frits in capillaries. Includes formamide, Kasil-1, Kasil-1624 and a cleaving tool.

    Tyrosine 3-monooxygenase (TH) ELISA Kit

    20-abx258488
    • EUR 8684.40
    • EUR 4626.00
    • EUR 1074.00
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    Mouse Squalene monooxygenase (SQLE) ELISA Kit

    abx390641-96tests 96 tests
    EUR 1093.2

    Rat Squalene monooxygenase (SQLE) ELISA Kit

    abx392005-96tests 96 tests
    EUR 1093.2

    Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E04A2009-192T 192 tests
    EUR 1524
    Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E04A2009-48 1 plate of 48 wells
    EUR 624
    Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E04A2009-96 1 plate of 96 wells
    EUR 822
    Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E07A2009-192T 192 tests
    EUR 1524
    Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E07A2009-48 1 plate of 48 wells
    EUR 624
    Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E07A2009-96 1 plate of 96 wells
    EUR 822
    Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E06A2009-192T 192 tests
    EUR 1524
    Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E06A2009-48 1 plate of 48 wells
    EUR 624
    Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E06A2009-96 1 plate of 96 wells
    EUR 822
    Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E03A2009-192T 192 tests
    EUR 1524
    Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E03A2009-48 1 plate of 48 wells
    EUR 624
    Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E03A2009-96 1 plate of 96 wells
    EUR 822
    Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E08A2009-192T 192 tests
    EUR 1524
    Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E08A2009-48 1 plate of 48 wells
    EUR 624
    Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E08A2009-96 1 plate of 96 wells
    EUR 822
    Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Mouse Alkylglycerol monooxygenase, Agmo ELISA KIT

    ELI-24173m 96 Tests
    EUR 1038

    Mouse Squalene monooxygenase, Sqle ELISA KIT

    ELI-26561m 96 Tests
    EUR 1038

    Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E02A2009-192T 192 tests
    EUR 1524
    Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E02A2009-48 1 plate of 48 wells
    EUR 624
    Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E02A2009-96 1 plate of 96 wells
    EUR 822
    Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit

    GA-E0825RT-48T 48T
    EUR 380.4

    Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit

    GA-E0825RT-96T 96T
    EUR 595.2

    Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E09A2009-192T 192 tests
    EUR 1524
    Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E09A2009-48 1 plate of 48 wells
    EUR 624
    Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E09A2009-96 1 plate of 96 wells
    EUR 822
    Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit

    QY-E10827 96T
    EUR 433.2

    Mouse Alkylglycerol Monooxygenase(AGMO)ELISA Kit

    QY-E20067 96T
    EUR 433.2

    TGF-b-1 Transforming Growth Factor-beta 1 Human protein

    PROTP01137-1 Regular: 2.5ug
    EUR 1388.4
    Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.

    YWHAE Tyr-3/Trp- 5 Monooxygenase Activation Protein Epsilon Human Recombinant Protein

    PROTP62258-1 Regular: 20ug
    EUR 380.4
    Description: YWHAE Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 255 amino acids (1-255) and having a molecular mass of 29 kDa. ;YWHAE is purified by proprietary chromatographic techniques.

    Luciferase Firefly, Luciferin 4-Monooxygenase Firefly Recombinant Protein, Active

    PROTP08659-1 Regular: 5ug
    EUR 380.4
    Description: Luciferase produced in E.Coli is a single, non-glycosylated polypeptide chain containing 335 amino acids (1-311 a.a) and having a molecular mass of 38.5kDa.; Luciferase is fused to a 24 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

    IL-1 beta, rat recombinant

    P1019-1 1 mg
    EUR 8745.6
    Description: Interleukin 1 beta (IL-1?) is a proinflammatory cytokine and is produced by activated macrophages, monocytes, keratinocytes and other epithelial cells. Both IL-1? and IL-1? bind to the same receptor and have similar biological properties.

    Sqle ELISA Kit| Mouse Squalene monooxygenase ELISA Kit

    EF016284 96 Tests
    EUR 826.8

    Sqle ELISA Kit| Rat Squalene monooxygenase ELISA Kit

    EF019365 96 Tests
    EUR 826.8

    PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9

    PROTP11464-1 Regular: 10ug
    EUR 380.4
    Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    20-abx152632
    • EUR 8853.60
    • EUR 4719.60
    • EUR 1093.20
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    Human Flavin Containing Monooxygenase 2 (FMO2) ELISA Kit

    abx387386-96tests 96 tests
    EUR 1093.2

    Human Flavin Containing Monooxygenase 5 (FMO5) ELISA Kit

    abx387387-96tests 96 tests
    EUR 1093.2

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    DLR-PAM-Hu-48T 48T
    EUR 620.4
    Description: A sandwich quantitative ELISA assay kit for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates or other biological fluids.

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    DLR-PAM-Hu-96T 96T
    EUR 807.6
    Description: A sandwich quantitative ELISA assay kit for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates or other biological fluids.

    ELISA kit for Human KMO (Kynurenine-3-Monooxygenase)

    ELK4176 1 plate of 96 wells
    EUR 518.4
    Description: A sandwich ELISA kit for detection of Kynurenine-3-Monooxygenase from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

    Human CYP7A1(Cholesterol 7-alpha-monooxygenase) ELISA Kit

    EH1191 96T
    EUR 628.92
    Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

    ELISA kit for Human Cholesterol 7-alpha-monooxygenase

    EK2656 96 tests
    EUR 663.6
    Description: Enzyme-linked immunosorbent assay kit for quantification of Human Cholesterol 7-alpha-monooxygenase in samples from serum, plasma, tissue homogenates and other biological fluids.

    Human CYP7A1/ Cholesterol 7-alpha-monooxygenase ELISA Kit

    E0651Hu 1 Kit
    EUR 685.2

    Human Cholesterol 7- alpha- monooxygenase, CYP7A1 ELISA KIT

    ELI-03412h 96 Tests
    EUR 988.8

    Human Ubiquinone biosynthesis monooxygenase COQ6, COQ6 ELISA KIT

    ELI-09305h 96 Tests
    EUR 988.8

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    RD-PAM-Hu-48Tests 48 Tests
    EUR 625.2

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    RD-PAM-Hu-96Tests 96 Tests
    EUR 867.6

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    RDR-PAM-Hu-48Tests 48 Tests
    EUR 652.8

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    RDR-PAM-Hu-96Tests 96 Tests
    EUR 907.2

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    SEC744Hu-10x96wellstestplate 10x96-wells test plate
    EUR 5677.8
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids.

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    SEC744Hu-1x48wellstestplate 1x48-wells test plate
    EUR 572.76
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids.

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    SEC744Hu-1x96wellstestplate 1x96-wells test plate
    EUR 766.8
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids.

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    SEC744Hu-5x96wellstestplate 5x96-wells test plate
    EUR 3090.6
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids.

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    4-SEC744Hu
    • EUR 5738.40
    • EUR 3031.20
    • EUR 768.00
    • 10 plates of 96 wells
    • 5 plates of 96 wells
    • 1 plate of 96 wells
    Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

    Human Peptidylglycine Alpha Amidating Monooxygenase ELISA Kit (PAM)

    RK02013 96 Tests
    EUR 625.2

    Human Hexokinase-1 AssayMax ELISA Kit

    EH3101-1 96 Well Plate
    EUR 572.4

    Human Glutaredoxin-1 AssayMax ELISA Kit

    EG2153-1 96 Well Plate
    EUR 500.4

    Human Complexin-1 AssayMax ELISA Kit

    EC3505-1 96 Well Plate
    EUR 500.4

    Column Packing Kit

    PACK-KIT 1pack
    EUR 1242
    Description: Column packing kit for pressure cells. Includes: HPREG regulator, TBNG10 tubing, CAP-75 capillary, and STRB5X2 stir bar.

    Human Tubulin beta-1 chain(TUBB1) ELISA kit

    1-CSB-EL025319HU
    • EUR 964.80
    • EUR 6118.80
    • EUR 3244.80
    • 1 plate of 96 wells
    • 10 plates of 96 wells each
    • 5 plates of 96 wells each
    Description: Quantitativesandwich ELISA kit for measuring Human Tubulin beta-1 chain(TUBB1) in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.