Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit
Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit
To Order Contact us:
![]() |
|||
RDR-bCMO1-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 544 |
![]() |
|||
RDR-bCMO1-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 756 |
![]() |
|||
RD-bCMO1-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 521 |
![]() |
|||
RD-bCMO1-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 723 |
![]() |
|||
abx025732-400ul | Abbexa | 400 ul | EUR 523 |
|
![]() |
|||
abx025732-80l | Abbexa | 80 µl | EUR 286 |
|
![]() |
|||
20-abx130708 | Abbexa |
|
|
|
![]() |
|||
abx122471-100ug | Abbexa | 100 ug | EUR 391 |
|
![]() |
|||
20-abx171410 | Abbexa |
|
|
|
![]() |
|||
abx230851-100ug | Abbexa | 100 ug | EUR 481 |
|
![]() |
|||
4-RPE246Hu01 | Cloud-Clone |
|
|
|
|||
Description: Recombinant Human Beta-Carotene-15,15'-Monooxygenase 1 expressed in: E.coli |
![]() |
|||
20-abx150797 | Abbexa |
|
|
|
![]() |
|||
SEE246Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 4731.5 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
![]() |
|||
SEE246Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 477.3 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
![]() |
|||
SEE246Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 639 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
![]() |
|||
SEE246Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 2575.5 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
![]() |
|||
ELI-10937h | Lifescience Market | 96 Tests | EUR 824 |
![]() |
|||
20-abx650585 | Abbexa |
|
|
|
![]() |
|||
ELI-11036m | Lifescience Market | 96 Tests | EUR 865 |
![]() |
|||
20-abx494551 | Abbexa |
|
|
|
![]() |
|||
ELK4791 | ELK Biotech | 1 plate of 96 wells | EUR 432 |
|
|||
Description: A sandwich ELISA kit for detection of Beta-Carotene-15,15'-Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
![]() |
|||
4-SEE246Hu | Cloud-Clone |
|
|
|
|||
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species. |
![]() |
|||
4-PAE246Hu01 | Cloud-Clone |
|
|
|
|||
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) |
![]() |
|||
4-PAE246Hu01-APC | Cloud-Clone |
|
|
|
|||
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC. |
![]() |
|||
4-PAE246Hu01-Biotin | Cloud-Clone |
|
|
|
|||
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Biotin. |
![]() |
|||
4-PAE246Hu01-Cy3 | Cloud-Clone |
|
|
|
|||
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Cy3. |
![]() |
|||
4-PAE246Hu01-FITC | Cloud-Clone |
|
|
|
|||
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with FITC. |
![]() |
|||
4-PAE246Hu01-HRP | Cloud-Clone |
|
|
|
|||
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with HRP. |
![]() |
|||
4-PAE246Hu01-PE | Cloud-Clone |
|
|
|
|||
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with PE. |
![]() |
|||
abx392200-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
abx391017-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
abx388677-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
4-PAE246Hu01-APC-Cy7 | Cloud-Clone |
|
|
|
|||
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC-Cy7. |
![]() |
|||
20-abx310811 | Abbexa |
|
|
|
![]() |
|||
20-abx310812 | Abbexa |
|
|
|
![]() |
|||
20-abx310813 | Abbexa |
|
|
|
![]() |
|||
20-abx310814 | Abbexa |
|
|
|
![]() |
|||
QY-E05643 | Qayee Biotechnology | 96T | EUR 361 |
![]() |
|||
GP8334-10G | Glentham Life Sciences | 10 g | EUR 102 |
![]() |
|||
GP8334-1G | Glentham Life Sciences | 1 g | EUR 48 |
![]() |
|||
GP8334-25G | Glentham Life Sciences | 25 g | EUR 174 |
![]() |
|||
GP8334-5G | Glentham Life Sciences | 5 g | EUR 74 |
![]() |
|||
TB0299 | ChemNorm | 8XX100mg | EUR 274 |
![]() |
|||
ELISA-1 | Alpha Diagnostics | 1 | EUR 202 |
![]() |
|||
ELI-33406r | Lifescience Market | 96 Tests | EUR 886 |
![]() |
|||
E0265Hu | Sunlong | 1 Kit | EUR 605 |
![]() |
|||
abx250481-96tests | Abbexa | 96 tests | EUR 668 |
|
![]() |
|||
EK2713 | SAB | 96 tests | EUR 553 |
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Beta,beta-carotene 9',10'-oxygenase in samples from serum, plasma, tissue homogenates and other biological fluids. |
![]() |
|||
EH1224 | FN Test | 96T | EUR 567.6 |
|
|||
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.469 ng/ml |
![]() |
|||
ELI-49386h | Lifescience Market | 96 Tests | EUR 824 |
![]() |
|||
E0170Mo | Sunlong | 1 Kit | EUR 632 |
![]() |
|||
abx515122-96tests | Abbexa | 96 tests | EUR 739 |
|
![]() |
|||
ELI-49387m | Lifescience Market | 96 Tests | EUR 865 |
![]() |
|||
EI2200-1 | AssayPro | 96 Well Plate | EUR 477 |
![]() |
|||
OKCD04382 | Aviva Systems Biology | 96 Wells | EUR 831 |
Description: Description of target: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich ELISA;Sensitivity: 0.49 ng/mL |
![]() |
|||
ET3102-1 | AssayPro | 96 Well Plate | EUR 477 |
![]() |
|||
ELI-25375c | Lifescience Market | 96 Tests | EUR 928 |
![]() |
|||
20-abx003844 | Abbexa |
|
|
|
![]() |
|||
abx122472-100ug | Abbexa | 100 ug | EUR 391 |
|
![]() |
|||
abx230852-100ug | Abbexa | 100 ug | EUR 481 |
|
![]() |
|||
EMI2200-1 | AssayPro | 96 Well Plate | EUR 477 |
![]() |
|||
PROTP31946-1 | BosterBio | Regular: 25ug | EUR 317 |
Description: YWHAB Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and having a molecular mass of 28kDa. ;YWHAB is purified by proprietary chromatographic techniques. |
![]() |
|||
HY-N0411 | MedChemExpress | 50mg | EUR 108 |
![]() |
|||
TBZ2607 | ChemNorm | 5mg | Ask for price |
![]() |
|||
ELI-23191h | Lifescience Market | 96 Tests | EUR 824 |
![]() |
|||
abx385151-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
20-abx909008 | Abbexa |
|
|
|
![]() |
|||
20-abx909009 | Abbexa |
|
|
|
![]() |
|||
DLR-FMO1-Hu-48T | DL Develop | 48T | EUR 517 |
|
|||
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids. |
![]() |
|||
DLR-FMO1-Hu-96T | DL Develop | 96T | EUR 673 |
|
|||
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids. |
![]() |
|||
20-abx151570 | Abbexa |
|
|
|
![]() |
|||
abx381498-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
RDR-FMO1-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 544 |
![]() |
|||
RDR-FMO1-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 756 |
![]() |
|||
SEF458Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 4731.5 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
![]() |
|||
SEF458Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 477.3 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
![]() |
|||
SEF458Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 639 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
![]() |
|||
SEF458Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 2575.5 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
![]() |
|||
4-SEF458Hu | Cloud-Clone |
|
|
|
|||
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
![]() |
|||
RD-FMO1-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 521 |
![]() |
|||
RD-FMO1-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 723 |
![]() |
|||
EXOAB-KIT-1 | SBI | 25 ul each | EUR 627 |
|
![]() |
|||
MR-KIT-1 | SBI | 5 reactions | EUR 1152 |
|
![]() |
|||
201-12-2419 | SunredBio | 96 tests | EUR 440 |
|
|||
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
![]() |
|||
E01A2009-192T | B-Gene | 192 tests | EUR 1270 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E01A2009-48 | B-Gene | 1 plate of 48 wells | EUR 520 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E01A2009-96 | B-Gene | 1 plate of 96 wells | EUR 685 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E2385Hu | Sunlong | 1 Kit | EUR 605 |
![]() |
|||
ELI-24195h | Lifescience Market | 96 Tests | EUR 824 |
![]() |
|||
EF005180 | Lifescience Market | 96 Tests | EUR 689 |
![]() |
|||
ELI-32784h | Lifescience Market | 96 Tests | EUR 824 |
![]() |
|||
QY-E01119 | Qayee Biotechnology | 96T | EUR 361 |
![]() |
|||
PIN320A-KIT | SBI | 1 Kit | EUR 4941 |
|
![]() |
|||
ELI-23404c | Lifescience Market | 96 Tests | EUR 928 |
![]() |
|||
ELI-42078p | Lifescience Market | 96 Tests | EUR 928 |
![]() |
|||
ELI-45646m | Lifescience Market | 96 Tests | EUR 865 |
![]() |
|||
abx391608-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
abx389876-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
20-abx959976 | Abbexa |
|
|
|
![]() |
|||
RP036973 | ABM | 100 ug | Ask for price |
![]() |
|||
RP036976 | ABM | 100 ug | Ask for price |
![]() |
|||
PIN340iPS-KIT | SBI | 1 Kit | EUR 4941 |
|
![]() |
|||
EM5001-1 | AssayPro | 96 Well Plate | EUR 417 |
![]() |
|||
20-abx214774 | Abbexa |
|
|
|
![]() |
|||
20-abx214826 | Abbexa |
|
|
|
![]() |
|||
20-abx241015 | Abbexa |
|
|
|
![]() |
|||
20-abx241094 | Abbexa |
|
|
|
![]() |
|||
20-abx329250 | Abbexa |
|
|
|
![]() |
|||
abx332554-100ul | Abbexa | 100 ul | EUR 425 |
|
![]() |
|||
EF018966 | Lifescience Market | 96 Tests | EUR 689 |
![]() |
|||
EF015513 | Lifescience Market | 96 Tests | EUR 689 |
![]() |
|||
EF012392 | Lifescience Market | 96 Tests | EUR 689 |
![]() |
|||
ELK4594 | ELK Biotech | 1 plate of 96 wells | EUR 432 |
|
|||
Description: A sandwich ELISA kit for detection of Flavin Containing Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
![]() |
|||
ELI-43781h | Lifescience Market | 96 Tests | EUR 824 |
![]() |
|||
A1124-1 | ApexBio | 1 mg | EUR 189 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
![]() |
|||
PROTQ02297-1 | BosterBio | 50ug | EUR 317 |
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues). |
![]() |
|||
K0177302 | ABM | 1.0 ug DNA | EUR 154 |
![]() |
|||
29452-100ul | SAB | 100ul | EUR 252 |
![]() |
|||
29452-50ul | SAB | 50ul | EUR 187 |
![]() |
|||
A15848-100ul | Abclonal | 100 ul | EUR 308 |
![]() |
|||
A15848-200ul | Abclonal | 200 ul | EUR 459 |
![]() |
|||
A15848-20ul | Abclonal | 20 ul | EUR 183 |
![]() |
|||
A15848-50ul | Abclonal | 50 ul | EUR 223 |
![]() |
|||
CSB-CL864015HU1-10ug | Cusabio | 10ug | EUR 376 |
|
|||
Description: A cloning plasmid for the BCMO1 gene. |
![]() |
|||
CSB-CL864015HU2-10ug | Cusabio | 10ug | EUR 570 |
|
|||
Description: A cloning plasmid for the BCMO1 gene. |
![]() |
|||
FNab00851 | FN Test | 100µg | EUR 505.25 |
|
|||
Description: Antibody raised against BCMO1 |
![]() |
|||
PAab00851 | Lifescience Market | 100 ug | EUR 355 |
![]() |
|||
A1002-1 | ApexBio | 1 mg | EUR 102 |
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein. |
![]() |
|||
DLR-KMO-Hu-48T | DL Develop | 48T | EUR 517 |
|
|||
Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids. |
![]() |
|||
DLR-KMO-Hu-96T | DL Develop | 96T | EUR 673 |
|
|||
Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids. |
![]() |
|||
E01K0092-192T | B-Gene | 192 tests | EUR 1270 |
|
|||
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E01K0092-48 | B-Gene | 1 plate of 48 wells | EUR 520 |
|
|||
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E01K0092-96 | B-Gene | 1 plate of 96 wells | EUR 685 |
|
|||
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
20-abx152142 | Abbexa |
|
|
|
![]() |
|||
E1395Hu | Sunlong | 1 Kit | EUR 605 |
![]() |
|||
E2487Hu | Sunlong | 1 Kit | EUR 571 |
![]() |
|||
EH14776 | FN Test | 96T | EUR 567.6 |
|
|||
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
![]() |
|||
EH1602 | FN Test | 96T | EUR 524.1 |
|
|||
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
![]() |
|||
ELI-04696h | Lifescience Market | 96 Tests | EUR 824 |
![]() |
|||
ELI-46405h | Lifescience Market | 96 Tests | EUR 824 |
![]() |
|||
abx573591-96tests | Abbexa | 96 tests | EUR 668 |
|
![]() |
|||
abx386638-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
KTE60353-48T | Abbkine | 48T | EUR 332 |
|
|||
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
![]() |
|||
KTE60353-5platesof96wells | Abbkine | 5 plates of 96 wells | EUR 2115 |
|
|||
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
![]() |
|||
KTE60353-96T | Abbkine | 96T | EUR 539 |
|
|||
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
![]() |
|||
QY-E01153 | Qayee Biotechnology | 96T | EUR 361 |
![]() |
|||
QY-E01801 | Qayee Biotechnology | 96T | EUR 361 |
![]() |
|||
RDR-KMO-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 544 |
![]() |
|||
RDR-KMO-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 756 |
![]() |
|||
RD-KMO-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 521 |
![]() |
|||
RD-KMO-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 723 |
![]() |
|||
SEH755Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 4731.5 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
![]() |
|||
SEH755Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 477.3 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
![]() |
|||
SEH755Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 639 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
![]() |
|||
SEH755Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 2575.5 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
![]() |
|||
4-SEH755Hu | Cloud-Clone |
|
|
|
|||
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
![]() |
|||
PIN300A-KIT | SBI | 1 Kit | EUR 2798 |
|
![]() |
|||
CAS510A-KIT | SBI | 1 Kit | EUR 805 |
|
![]() |
|||
PROTP10749-1 | BosterBio | Regular: 25ug | EUR 317 |
Description: Interleukin-1 beta Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 189 amino acids and having a molecular mass of 21 kDa. ;The IL-1b is fused to His-Tag and purified by proprietary chromatographic techniques. |
![]() |
|||
ORF012325 | ABM | 1.0 ug DNA | EUR 354 |
![]() |
|||
ORF012326 | ABM | 1.0 ug DNA | EUR 354 |
![]() |
|||
PIN400A-KIT | SBI | 1 Kit | EUR 2798 |
|
![]() |
|||
E01D0299-192T | B-Gene | 192 tests | EUR 1270 |
|
|||
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E01D0299-48 | B-Gene | 1 plate of 48 wells | EUR 520 |
|
|||
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E01D0299-96 | B-Gene | 1 plate of 96 wells | EUR 685 |
|
|||
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
KTE61571-48T | Abbkine | 48T | EUR 332 |
|
|||
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
![]() |
|||
KTE61571-5platesof96wells | Abbkine | 5 plates of 96 wells | EUR 2115 |
|
|||
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
![]() |
|||
KTE61571-96T | Abbkine | 96T | EUR 539 |
|
|||
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
![]() |
|||
PIN410A-KIT | SBI | 1 Kit | EUR 4335 |
|
![]() |
|||
PIN412A-KIT | SBI | 1 Kit | EUR 4335 |
|
![]() |
|||
20-abx494912 | Abbexa |
|
|
|
![]() |
|||
PROTP05556-1 | BosterBio | Regular: 10ug | EUR 317 |
Description: ITGB1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 716 amino acids (1-728) and having a molecular mass of 79.4kDa (Molecular size on SDS-PAGE will appear at approximately 70-100kDa). ITGB1 is fused to an 8 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques.  |
![]() |
|||
abx259843-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
P1019-1 | ApexBio | 1 mg | EUR 7288 |
Description: Interleukin 1 beta (IL-1?) is a proinflammatory cytokine and is produced by activated macrophages, monocytes, keratinocytes and other epithelial cells. Both IL-1? and IL-1? bind to the same receptor and have similar biological properties. |
![]() |
|||
PROTP01137-1 | BosterBio | Regular: 2.5ug | EUR 1157 |
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques. |
![]() |
|||
PROTP08659-1 | BosterBio | Regular: 5ug | EUR 317 |
Description: Luciferase produced in E.Coli is a single, non-glycosylated polypeptide chain containing 335 amino acids (1-311 a.a) and having a molecular mass of 38.5kDa.; Luciferase is fused to a 24 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques. |
![]() |
|||
PROTP62258-1 | BosterBio | Regular: 20ug | EUR 317 |
Description: YWHAE Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 255 amino acids (1-255) and having a molecular mass of 29 kDa. ;YWHAE is purified by proprietary chromatographic techniques. |
![]() |
|||
AP-STR-KIT-1 | CORNING | 1/pk | EUR 355 |
Description: Corning and Axygen Liquid Handling Equipment; Axypet Pipettors and Motopet Pipet Controller |
![]() |
|||
E03A2009-192T | B-Gene | 192 tests | EUR 1270 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E03A2009-48 | B-Gene | 1 plate of 48 wells | EUR 520 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E03A2009-96 | B-Gene | 1 plate of 96 wells | EUR 685 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E06A2009-192T | B-Gene | 192 tests | EUR 1270 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E06A2009-48 | B-Gene | 1 plate of 48 wells | EUR 520 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E06A2009-96 | B-Gene | 1 plate of 96 wells | EUR 685 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E04A2009-192T | B-Gene | 192 tests | EUR 1270 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E04A2009-48 | B-Gene | 1 plate of 48 wells | EUR 520 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E04A2009-96 | B-Gene | 1 plate of 96 wells | EUR 685 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E02A2009-192T | B-Gene | 192 tests | EUR 1270 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E02A2009-48 | B-Gene | 1 plate of 48 wells | EUR 520 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E02A2009-96 | B-Gene | 1 plate of 96 wells | EUR 685 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E07A2009-192T | B-Gene | 192 tests | EUR 1270 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E07A2009-48 | B-Gene | 1 plate of 48 wells | EUR 520 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E07A2009-96 | B-Gene | 1 plate of 96 wells | EUR 685 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
20-abx258488 | Abbexa |
|
|
|
![]() |
|||
E08A2009-192T | B-Gene | 192 tests | EUR 1270 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E08A2009-48 | B-Gene | 1 plate of 48 wells | EUR 520 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E08A2009-96 | B-Gene | 1 plate of 96 wells | EUR 685 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E09A2009-192T | B-Gene | 192 tests | EUR 1270 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E09A2009-48 | B-Gene | 1 plate of 48 wells | EUR 520 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
E09A2009-96 | B-Gene | 1 plate of 96 wells | EUR 685 |
|
|||
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() |
|||
ELI-24173m | Lifescience Market | 96 Tests | EUR 865 |
![]() |
|||
ELI-26561m | Lifescience Market | 96 Tests | EUR 865 |
![]() |
|||
abx392005-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
abx390641-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
GA-E0825RT-48T | GenAsia Biotech | 48T | EUR 317 |
![]() |
|||
GA-E0825RT-96T | GenAsia Biotech | 96T | EUR 496 |
![]() |
|||
QY-E10827 | Qayee Biotechnology | 96T | EUR 361 |
![]() |
|||
QY-E20067 | Qayee Biotechnology | 96T | EUR 361 |
![]() |
|||
PROTP11464-1 | BosterBio | Regular: 10ug | EUR 317 |
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques. |
![]() |
|||
FRIT-KIT | Next Advance | 1each | EUR 124 |
Description: Kit to create frits in capillaries. Includes formamide, Kasil-1, Kasil-1624 and a cleaving tool. |
![]() |
|||
EF019365 | Lifescience Market | 96 Tests | EUR 689 |
![]() |
|||
EF016284 | Lifescience Market | 96 Tests | EUR 689 |
![]() |
|||
ELI-14227c | Lifescience Market | 96 Tests | EUR 928 |
![]() |
|||
ELI-38586m | Lifescience Market | 96 Tests | EUR 865 |
![]() |
|||
DLR-PAM-Hu-48T | DL Develop | 48T | EUR 517 |
|
|||
Description: A sandwich quantitative ELISA assay kit for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates or other biological fluids. |
![]() |
|||
DLR-PAM-Hu-96T | DL Develop | 96T | EUR 673 |
|
|||
Description: A sandwich quantitative ELISA assay kit for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates or other biological fluids. |
![]() |
|||
E0651Hu | Sunlong | 1 Kit | EUR 571 |
![]() |
|||
20-abx152632 | Abbexa |
|
|
|
![]() |
|||
EK2656 | SAB | 96 tests | EUR 553 |
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Cholesterol 7-alpha-monooxygenase in samples from serum, plasma, tissue homogenates and other biological fluids. |
![]() |
|||
EH1191 | FN Test | 96T | EUR 524.1 |
|
|||
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
![]() |
|||
ELI-09305h | Lifescience Market | 96 Tests | EUR 824 |
![]() |
|||
ELI-03412h | Lifescience Market | 96 Tests | EUR 824 |
![]() |
|||
ELK4176 | ELK Biotech | 1 plate of 96 wells | EUR 432 |
|
|||
Description: A sandwich ELISA kit for detection of Kynurenine-3-Monooxygenase from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
![]() |
|||
abx387386-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
abx387387-96tests | Abbexa | 96 tests | EUR 911 |
|
![]() |
|||
RK02013 | Abclonal | 96 Tests | EUR 521 |
![]() |
|||
SEC744Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 4731.5 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids. |
![]() |
|||
SEC744Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 477.3 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids. |
![]() |
|||
SEC744Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 639 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids. |
![]() |
|||
SEC744Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 2575.5 |
|
|||
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids. |
![]() |
|||
4-SEC744Hu | Cloud-Clone |
|
|
|
|||
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
![]() |
|||
RDR-PAM-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 544 |
![]() |
|||
RDR-PAM-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 756 |
![]() |
|||
RD-PAM-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 521 |
![]() |
|||
RD-PAM-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 723 |
![]() |
|||
PROTQ15661-1 | BosterBio | Regular: 10ug | EUR 317 |
Description: TPSAB1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (31-275 a.a.) and fused to a 6 aa His Tag at C-terminus containing a total of 251 amino acids and having a molecular mass of 28.2kDa.TPSAB1 shows multiple bands between 28-40kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.  |
![]() |
|||
PROTP05026-1 | BosterBio | Regular: 10ug | EUR 317 |
Description: ATP1B1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 250 amino acids (63-303 a.a.) and having a molecular mass of 29kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa).;ATP1B1 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques. |
![]() |
|||
PROTP14415-1 | BosterBio | Regular: 10ug | EUR 317 |
Description: ATP1B2 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 232 amino acids (68-290a.a.) and having a molecular mass of 26.4kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa). ATP1B2 is expressed with a 9 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques. |
![]() |
|||
RA0111-C.1 | ScyTek Laboratories | 0.1 ml | EUR 125 |
![]() |
|||
PACK-KIT | Next Advance | 1pack | EUR 1035 |
Description: Column packing kit for pressure cells. Includes: HPREG regulator, TBNG10 tubing, CAP-75 capillary, and STRB5X2 stir bar. |
![]() |
|||
20-abx975231 | Abbexa |
|
|
|
![]() |
|||
C29452 | SAB | 100ul | EUR 397 |
![]() |
|||
RP192062 | ABM | 100 ug | Ask for price |
![]() |
|||
RP119363 | ABM | 100 ug | Ask for price |
![]() |
|||
RP119366 | ABM | 100 ug | Ask for price |
![]() |
|||
EH3101-1 | AssayPro | 96 Well Plate | EUR 477 |
![]() |
|||
EC3505-1 | AssayPro | 96 Well Plate | EUR 417 |
![]() |
|||
EG2153-1 | AssayPro | 96 Well Plate | EUR 417 |
![]() |
|||
PROTP01584-1 | BosterBio | Regular: 10ug | EUR 317 |
Description: Interleukin-1 beta Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17000 Dalton.;The IL-1b is purified by proprietary chromatographic techniques. |
![]() |
|||
PROTQ63264-1 | BosterBio | 10ug | EUR 317 |
Description: IL-1β is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1α and IL-1β binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1β is a secreted cytokine, IL-1α is predominantly a cell-associated cytokine. Recombinant rat IL-1β is a 17.4 kDa protein containing 153 amino acid residues. |