Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

To Order Contact us: 

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    RDR-bCMO1-Hu-48Tests 48 Tests
    EUR 544

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    RDR-bCMO1-Hu-96Tests 96 Tests
    EUR 756

    Recombinant Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1)

    4-RPE246Hu01
    • EUR 485.28
    • EUR 233.00
    • EUR 1544.80
    • EUR 581.60
    • EUR 1063.20
    • EUR 388.00
    • EUR 3712.00
    • 100 ug
    • 10ug
    • 1 mg
    • 200 ug
    • 500 ug
    • 50ug
    • 5 mg
    Description: Recombinant Human Beta-Carotene-15,15'-Monooxygenase 1 expressed in: E.coli

    Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Antibody

    20-abx130708
    • EUR 314.00
    • EUR 133.00
    • EUR 815.00
    • EUR 425.00
    • EUR 272.00
    • 100 ug
    • 10 ug
    • 1 mg
    • 200 ug
    • 50 ug

    beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

    abx122471-100ug 100 ug
    EUR 391

    Beta-Carotene-15,15-Monooxygenase 1 (bCMO1) Antibody

    20-abx171410
    • EUR 857.00
    • EUR 439.00
    • 1 mg
    • 200 ug

    beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

    abx230851-100ug 100 ug
    EUR 481

    beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

    abx025732-400ul 400 ul
    EUR 523

    beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

    abx025732-80l 80 µl
    EUR 286

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    SEE246Hu-10x96wellstestplate 10x96-wells test plate
    EUR 4731.5
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    SEE246Hu-1x48wellstestplate 1x48-wells test plate
    EUR 477.3
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    SEE246Hu-1x96wellstestplate 1x96-wells test plate
    EUR 639
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    SEE246Hu-5x96wellstestplate 5x96-wells test plate
    EUR 2575.5
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

    Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

    20-abx150797
    • EUR 7378.00
    • EUR 3933.00
    • EUR 911.00
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    Human Beta,beta- carotene 15,15'- monooxygenase, BCMO1 ELISA KIT

    ELI-10937h 96 Tests
    EUR 824

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Protein

    20-abx650585
    • EUR 676.00
    • EUR 286.00
    • EUR 2082.00
    • EUR 801.00
    • EUR 481.00
    • 100 ug
    • 10 ug
    • 1 mg
    • 200 ug
    • 50 ug

    Mouse Beta,beta- carotene 15,15'- monooxygenase, Bcmo1 ELISA KIT

    ELI-11036m 96 Tests
    EUR 865

    Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) CLIA Kit

    20-abx494551
    • EUR 7973.00
    • EUR 4246.00
    • EUR 981.00
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    ELISA kit for Human bCMO1 (Beta-Carotene-15,15'-Monooxygenase 1)

    ELK4791 1 plate of 96 wells
    EUR 432
    Description: A sandwich ELISA kit for detection of Beta-Carotene-15,15'-Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

    Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) ELISA Kit

    4-SEE246Hu
    • EUR 4782.00
    • EUR 2526.00
    • EUR 640.00
    • 10 plates of 96 wells
    • 5 plates of 96 wells
    • 1 plate of 96 wells
    Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human)

    4-PAE246Hu01
    • EUR 247.00
    • EUR 2510.00
    • EUR 625.00
    • EUR 310.00
    • EUR 214.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1)

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC

    4-PAE246Hu01-APC
    • EUR 345.00
    • EUR 3275.00
    • EUR 912.00
    • EUR 440.00
    • EUR 219.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC.

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Biotinylated

    4-PAE246Hu01-Biotin
    • EUR 311.00
    • EUR 2460.00
    • EUR 727.00
    • EUR 381.00
    • EUR 219.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Biotin.

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Cy3

    4-PAE246Hu01-Cy3
    • EUR 419.00
    • EUR 4325.00
    • EUR 1175.00
    • EUR 545.00
    • EUR 251.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Cy3.

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), FITC

    4-PAE246Hu01-FITC
    • EUR 296.00
    • EUR 2640.00
    • EUR 750.00
    • EUR 372.00
    • EUR 195.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with FITC.

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), HRP

    4-PAE246Hu01-HRP
    • EUR 316.00
    • EUR 2855.00
    • EUR 807.00
    • EUR 398.00
    • EUR 206.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with HRP.

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), PE

    4-PAE246Hu01-PE
    • EUR 296.00
    • EUR 2640.00
    • EUR 750.00
    • EUR 372.00
    • EUR 195.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with PE.

    Human Beta,beta-carotene 15,15'-dioxygenase (BCO1) ELISA Kit

    abx392200-96tests 96 tests
    EUR 911

    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC-Cy7

    4-PAE246Hu01-APC-Cy7
    • EUR 571.00
    • EUR 6430.00
    • EUR 1705.00
    • EUR 760.00
    • EUR 319.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC-Cy7.

    Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody

    20-abx310811
    • EUR 411.00
    • EUR 1845.00
    • EUR 599.00
    • EUR 182.00
    • EUR 300.00
    • 100 ug
    • 1 mg
    • 200 ug
    • 20 ug
    • 50 ug

    Mouse Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit

    abx388677-96tests 96 tests
    EUR 911

    Rat Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit

    abx391017-96tests 96 tests
    EUR 911

    Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (HRP)

    20-abx310812
    • EUR 411.00
    • EUR 1845.00
    • EUR 599.00
    • EUR 182.00
    • EUR 300.00
    • 100 ug
    • 1 mg
    • 200 ug
    • 20 ug
    • 50 ug

    Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (FITC)

    20-abx310813
    • EUR 411.00
    • EUR 1845.00
    • EUR 599.00
    • EUR 182.00
    • EUR 300.00
    • 100 ug
    • 1 mg
    • 200 ug
    • 20 ug
    • 50 ug

    Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (Biotin)

    20-abx310814
    • EUR 411.00
    • EUR 1845.00
    • EUR 599.00
    • EUR 182.00
    • EUR 300.00
    • 100 ug
    • 1 mg
    • 200 ug
    • 20 ug
    • 50 ug

    Human beta carotene

    QY-E05643 96T
    EUR 361

    Beta-Carotene

    TB0299 8XX100mg
    EUR 274

    beta-Carotene

    GP8334-10G 10 g
    EUR 102

    beta-Carotene

    GP8334-1G 1 g
    EUR 48

    beta-Carotene

    GP8334-25G 25 g
    EUR 174

    beta-Carotene

    GP8334-5G 5 g
    EUR 74

    Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed

    ELISA-1 1
    EUR 202

    Bcmo1/ Rat Bcmo1 ELISA Kit

    ELI-33406r 96 Tests
    EUR 886

    Human Beta,beta- carotene 9',10'- oxygenase, BCO2 ELISA KIT

    ELI-49386h 96 Tests
    EUR 824

    Human Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

    abx250481-96tests 96 tests
    EUR 668

    Human BCO2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit

    E0265Hu 1 Kit
    EUR 605

    ELISA kit for Human Beta,beta-carotene 9',10'-oxygenase

    EK2713 96 tests
    EUR 553
    Description: Enzyme-linked immunosorbent assay kit for quantification of Human Beta,beta-carotene 9',10'-oxygenase in samples from serum, plasma, tissue homogenates and other biological fluids.

    Human BCO2(Beta,beta-carotene 9',10'-oxygenase) ELISA Kit

    EH1224 96T
    EUR 567.6
    Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.469 ng/ml

    Mouse Beta,beta- carotene 9',10'- oxygenase, Bco2 ELISA KIT

    ELI-49387m 96 Tests
    EUR 865

    Mouse Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

    abx515122-96tests 96 tests
    EUR 739

    Mouse Bco2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit

    E0170Mo 1 Kit
    EUR 632

    Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

    EI2200-1 96 Well Plate
    EUR 477

    BCMO1 ELISA Kit (Human) (OKCD04382)

    OKCD04382 96 Wells
    EUR 831
    Description: Description of target: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich ELISA;Sensitivity: 0.49 ng/mL

    Chicken BCMO1 ELISA KIT

    ELI-25375c 96 Tests
    EUR 928

    Human TGF-beta-1 AssayMax ELISA Kit

    ET3102-1 96 Well Plate
    EUR 477

    Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

    abx122472-100ug 100 ug
    EUR 391

    Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

    abx230852-100ug 100 ug
    EUR 481

    Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

    20-abx003844
    • EUR 411.00
    • EUR 592.00
    • EUR 182.00
    • EUR 314.00
    • 100 ul
    • 200 ul
    • 20 ul
    • 50 ul

    YWHAB Tyr-3/Trp- 5 Monooxygenase Activation Protein Beta Human Recombinant Protein

    PROTP31946-1 Regular: 25ug
    EUR 317
    Description: YWHAB Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and having a molecular mass of 28kDa. ;YWHAB is purified by proprietary chromatographic techniques.

    Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

    EMI2200-1 96 Well Plate
    EUR 477

    alpha-Carotene

    TBZ2607 5mg Ask for price

    β-Carotene

    HY-N0411 50mg
    EUR 108

    Human Methylsterol monooxygenase 1, MSMO1 ELISA KIT

    ELI-23191h 96 Tests
    EUR 824

    Human Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

    abx385151-96tests 96 tests
    EUR 911

    BCMO1 siRNA

    20-abx909008
    • EUR 551.00
    • EUR 732.00
    • 15 nmol
    • 30 nmol

    BCMO1 siRNA

    20-abx909009
    • EUR 551.00
    • EUR 732.00
    • 15 nmol
    • 30 nmol

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    SEF458Hu-10x96wellstestplate 10x96-wells test plate
    EUR 4731.5
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    SEF458Hu-1x48wellstestplate 1x48-wells test plate
    EUR 477.3
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    SEF458Hu-1x96wellstestplate 1x96-wells test plate
    EUR 639
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    SEF458Hu-5x96wellstestplate 5x96-wells test plate
    EUR 2575.5
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    4-SEF458Hu
    • EUR 4782.00
    • EUR 2526.00
    • EUR 640.00
    • 10 plates of 96 wells
    • 5 plates of 96 wells
    • 1 plate of 96 wells
    Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

    Human Monooxygenase DBH Like 1 (MOXD1) ELISA Kit

    abx381498-96tests 96 tests
    EUR 911

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    20-abx151570
    • EUR 7378.00
    • EUR 3933.00
    • EUR 911.00
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    DLR-FMO1-Hu-48T 48T
    EUR 517
    Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    DLR-FMO1-Hu-96T 96T
    EUR 673
    Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    RD-FMO1-Hu-48Tests 48 Tests
    EUR 521

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    RD-FMO1-Hu-96Tests 96 Tests
    EUR 723

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    RDR-FMO1-Hu-48Tests 48 Tests
    EUR 544

    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

    RDR-FMO1-Hu-96Tests 96 Tests
    EUR 756

    BCMO1 Recombinant Protein (Human)

    RP036973 100 ug Ask for price

    BCMO1 Recombinant Protein (Human)

    RP036976 100 ug Ask for price

    Human BCMO1 shRNA Plasmid

    20-abx959976
    • EUR 801.00
    • EUR 1121.00
    • 150 µg
    • 300 µg

    Human Alkylglycerol monooxygenase, AGMO ELISA KIT

    ELI-24195h 96 Tests
    EUR 824

    Kynurenine 3-monooxygenase ELISA Kit|Human

    EF005180 96 Tests
    EUR 689

    Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E01A2009-192T 192 tests
    EUR 1270
    Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E01A2009-48 1 plate of 48 wells
    EUR 520
    Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E01A2009-96 1 plate of 96 wells
    EUR 685
    Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Squalene monooxygenase, SQLE ELISA KIT

    ELI-32784h 96 Tests
    EUR 824

    Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit

    201-12-2419 96 tests
    EUR 440
    Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

    Human SQLE/ Squalene monooxygenase ELISA Kit

    E2385Hu 1 Kit
    EUR 605

    Human Alkylglycerol Monooxygenase(AGMO)ELISA Kit

    QY-E01119 96T
    EUR 361

    Chicken Methylsterol monooxygenase 1, MSMO1 ELISA KIT

    ELI-23404c 96 Tests
    EUR 928

    Porcine Methylsterol monooxygenase 1, MSMO1 ELISA KIT

    ELI-42078p 96 Tests
    EUR 928

    Mouse Methylsterol monooxygenase 1, Msmo1 ELISA KIT

    ELI-45646m 96 Tests
    EUR 865

    Mouse Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

    abx389876-96tests 96 tests
    EUR 911

    Rat Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

    abx391608-96tests 96 tests
    EUR 911

    ExoAb Antibody Kit (CD9, CD63, CD81, Hsp70 antibodies, rabbit anti-human) with goat anti-rabbit HRP secondary antibody

    EXOAB-KIT-1 25 ul each
    EUR 627

    PinPoint-FC 293T Platform Kit for Targeted Gene Insertion (includes PIN320A-1, PIN200A-1, PIN510A-1 & PIN600A-1)

    PIN320A-KIT 1 Kit
    EUR 4941

    BCMO1 sgRNA CRISPR Lentivector (Human) (Target 1)

    K0177302 1.0 ug DNA
    EUR 154

    PinPoint-FC Murine iPSC Platform Kit for Targeted Gene Insertion (includes PIN340iPS-1, PIN200A-1, PIN510A-1 & PIN600A-1)

    PIN340iPS-KIT 1 Kit
    EUR 4941

    mRNAExpress mRNA Synthesis kit (5 reactions)

    MR-KIT-1 5 reactions
    EUR 1152

    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

    20-abx241015
    • EUR 411.00
    • EUR 300.00
    • 100 ul
    • 50 ul

    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

    20-abx241094
    • EUR 411.00
    • EUR 300.00
    • 100 ul
    • 50 ul

    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

    20-abx214774
    • EUR 411.00
    • EUR 300.00
    • 100 ul
    • 50 ul

    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

    20-abx214826
    • EUR 411.00
    • EUR 300.00
    • 100 ul
    • 50 ul

    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

    20-abx329250
    • EUR 314.00
    • EUR 244.00
    • 100 ug
    • 50 ug

    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

    abx332554-100ul 100 ul
    EUR 425

    Msmo1 ELISA Kit| Rat Methylsterol monooxygenase 1 ELISA Kit

    EF018966 96 Tests
    EUR 689

    Msmo1 ELISA Kit| Mouse Methylsterol monooxygenase 1 ELISA Kit

    EF015513 96 Tests
    EUR 689

    MSMO1 ELISA Kit| chicken Methylsterol monooxygenase 1 ELISA Kit

    EF012392 96 Tests
    EUR 689

    Human DBH- like monooxygenase protein 1, MOXD1 ELISA KIT

    ELI-43781h 96 Tests
    EUR 824

    ELISA kit for Human FMO1 (Flavin Containing Monooxygenase 1)

    ELK4594 1 plate of 96 wells
    EUR 432
    Description: A sandwich ELISA kit for detection of Flavin Containing Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

    Anti-BCMO1 antibody

    PAab00851 100 ug
    EUR 355

    BCMO1 cloning plasmid

    CSB-CL864015HU1-10ug 10ug
    EUR 376
    Description: A cloning plasmid for the BCMO1 gene.

    BCMO1 cloning plasmid

    CSB-CL864015HU2-10ug 10ug
    EUR 570
    Description: A cloning plasmid for the BCMO1 gene.

    BCMO1 Rabbit pAb

    A15848-100ul 100 ul
    EUR 308

    BCMO1 Rabbit pAb

    A15848-200ul 200 ul
    EUR 459

    BCMO1 Rabbit pAb

    A15848-20ul 20 ul
    EUR 183

    BCMO1 Rabbit pAb

    A15848-50ul 50 ul
    EUR 223

    BCMO1 Polyclonal Antibody

    29452-100ul 100ul
    EUR 252

    BCMO1 Polyclonal Antibody

    29452-50ul 50ul
    EUR 187

    anti- BCMO1 antibody

    FNab00851 100µg
    EUR 505.25
    Description: Antibody raised against BCMO1

    Recombinant Human Heregulin Beta -1 Protein

    PROTQ02297-1 50ug
    EUR 317
    Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues).

    Amyloid Beta-Peptide (1-40) (human)

    A1124-1 1 mg
    EUR 189
    Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

    Human Beta-2-Microglobulin (B2M) AssayMax ELISA Kit

    EM5001-1 96 Well Plate
    EUR 417

    BCMO1 ORF Vector (Human) (pORF)

    ORF012325 1.0 ug DNA
    EUR 354

    BCMO1 ORF Vector (Human) (pORF)

    ORF012326 1.0 ug DNA
    EUR 354

    Human Tyrosine 3- monooxygenase, TH ELISA KIT

    ELI-04696h 96 Tests
    EUR 824

    Human Kynurenine 3- monooxygenase, KMO ELISA KIT

    ELI-46405h 96 Tests
    EUR 824

    Human Kynurenine 3 monooxygenase(KMO) ELISA kit

    E01K0092-192T 192 tests
    EUR 1270
    Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Kynurenine 3 monooxygenase(KMO) ELISA kit

    E01K0092-48 1 plate of 48 wells
    EUR 520
    Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Kynurenine 3 monooxygenase(KMO) ELISA kit

    E01K0092-96 1 plate of 96 wells
    EUR 685
    Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    SEH755Hu-10x96wellstestplate 10x96-wells test plate
    EUR 4731.5
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    SEH755Hu-1x48wellstestplate 1x48-wells test plate
    EUR 477.3
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    SEH755Hu-1x96wellstestplate 1x96-wells test plate
    EUR 639
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    SEH755Hu-5x96wellstestplate 5x96-wells test plate
    EUR 2575.5
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    4-SEH755Hu
    • EUR 4782.00
    • EUR 2526.00
    • EUR 640.00
    • 10 plates of 96 wells
    • 5 plates of 96 wells
    • 1 plate of 96 wells
    Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

    Human Kynurenine 3-monooxygenase (KMO) ELISA Kit

    abx573591-96tests 96 tests
    EUR 668

    Human Coenzyme Q6, Monooxygenase (COQ6) ELISA Kit

    abx386638-96tests 96 tests
    EUR 911

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    20-abx152142
    • EUR 7378.00
    • EUR 3933.00
    • EUR 911.00
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    DLR-KMO-Hu-48T 48T
    EUR 517
    Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    DLR-KMO-Hu-96T 96T
    EUR 673
    Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids.

    ELISA kit for Human Squalene monooxygenase (SQLE)

    KTE60353-48T 48T
    EUR 332
    Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

    ELISA kit for Human Squalene monooxygenase (SQLE)

    KTE60353-5platesof96wells 5 plates of 96 wells
    EUR 2115
    Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

    ELISA kit for Human Squalene monooxygenase (SQLE)

    KTE60353-96T 96T
    EUR 539
    Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    RD-KMO-Hu-48Tests 48 Tests
    EUR 521

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    RD-KMO-Hu-96Tests 96 Tests
    EUR 723

    Human TH/ Tyrosine 3-monooxygenase ELISA Kit

    E2487Hu 1 Kit
    EUR 571

    Human KMO/ Kynurenine 3-monooxygenase ELISA Kit

    E1395Hu 1 Kit
    EUR 605

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    RDR-KMO-Hu-48Tests 48 Tests
    EUR 544

    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

    RDR-KMO-Hu-96Tests 96 Tests
    EUR 756

    Human KMO(Kynurenine 3-monooxygenase) ELISA Kit

    EH14776 96T
    EUR 567.6
    Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

    Human TH(Tyrosine 3-monooxygenase) ELISA Kit

    EH1602 96T
    EUR 524.1
    Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

    Human Deoxyhypusine Hydroxylase/Monooxygenase(DOHH)ELISA Kit

    QY-E01153 96T
    EUR 361

    Human Kynurenine-3-Monooxygenase(KMO)ELISA Kit

    QY-E01801 96T
    EUR 361

    PinPoint-FC System for Platform Cell Line Generation & Retargeting (includes PIN300A-1, FC200PA-1, PIN200A-1, PIN510A-1, & PIN600A-1)

    PIN300A-KIT 1 Kit
    EUR 2798

    Beta-Amyloid (1-11)

    A1002-1 1 mg
    EUR 102
    Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein.

    Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit

    E01D0299-192T 192 tests
    EUR 1270
    Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit

    E01D0299-48 1 plate of 48 wells
    EUR 520
    Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit

    E01D0299-96 1 plate of 96 wells
    EUR 685
    Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1)

    KTE61571-48T 48T
    EUR 332
    Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

    ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1)

    KTE61571-5platesof96wells 5 plates of 96 wells
    EUR 2115
    Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

    ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1)

    KTE61571-96T 96T
    EUR 539
    Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

    PinPoint-HR System for Platform Cell Line Generation & Retargeting (includes PIN400A-1, PIN200A-1, PIN510A-1, & PIN600A-1)

    PIN400A-KIT 1 Kit
    EUR 2798

    Human Flavin Containing Monooxygenase 1 (FMO1) CLIA Kit

    20-abx494912
    • EUR 7973.00
    • EUR 4246.00
    • EUR 981.00
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    T7 gRNA SmartNuclease Synthesis Kit (includes CAS510A-1 & T7 IVT synthesis reagents)

    CAS510A-KIT 1 Kit
    EUR 805

    PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, GE601A-1, PIN200A-1, PIN510A-1, & PIN600A-1)

    PIN410A-KIT 1 Kit
    EUR 4335

    PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, CAS601A-1, PIN200A-1, PIN510A-1, & PIN600A-1)

    PIN412A-KIT 1 Kit
    EUR 4335

    IL-1-beta Interleukin-1 beta Mouse Recombinant Protein, His Tag

    PROTP10749-1 Regular: 25ug
    EUR 317
    Description: Interleukin-1 beta Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 189 amino acids and having a molecular mass of 21 kDa. ;The IL-1b is fused to His-Tag and purified by proprietary chromatographic techniques.

    Human SIRP BETA 1 (SIRP BETA 1) ELISA Kit

    abx259843-96tests 96 tests
    EUR 911

    ITGB1 Human, Integrin Beta 1 Human Recombinant Protein, Sf9

    PROTP05556-1 Regular: 10ug
    EUR 317
    Description: ITGB1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 716 amino acids (1-728) and having a molecular mass of 79.4kDa (Molecular size on SDS-PAGE will appear at approximately 70-100kDa). ITGB1 is fused to an 8 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques. 

    TGF-b-1 Transforming Growth Factor-beta 1 Human protein

    PROTP01137-1 Regular: 2.5ug
    EUR 1157
    Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.

    BCMO1 Recombinant Protein (Rat)

    RP192062 100 ug Ask for price

    BCMO1 Recombinant Protein (Mouse)

    RP119363 100 ug Ask for price

    BCMO1 Recombinant Protein (Mouse)

    RP119366 100 ug Ask for price

    Mouse BCMO1 shRNA Plasmid

    20-abx975231
    • EUR 801.00
    • EUR 1121.00
    • 150 µg
    • 300 µg

    BCMO1 Polyclonal Conjugated Antibody

    C29452 100ul
    EUR 397

    IL-1 beta, rat recombinant

    P1019-1 1 mg
    EUR 7288
    Description: Interleukin 1 beta (IL-1?) is a proinflammatory cytokine and is produced by activated macrophages, monocytes, keratinocytes and other epithelial cells. Both IL-1? and IL-1? bind to the same receptor and have similar biological properties.

    Mouse Alkylglycerol monooxygenase, Agmo ELISA KIT

    ELI-24173m 96 Tests
    EUR 865

    Mouse Squalene monooxygenase, Sqle ELISA KIT

    ELI-26561m 96 Tests
    EUR 865

    Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E02A2009-192T 192 tests
    EUR 1270
    Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E02A2009-48 1 plate of 48 wells
    EUR 520
    Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E02A2009-96 1 plate of 96 wells
    EUR 685
    Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E03A2009-192T 192 tests
    EUR 1270
    Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E03A2009-48 1 plate of 48 wells
    EUR 520
    Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E03A2009-96 1 plate of 96 wells
    EUR 685
    Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E04A2009-192T 192 tests
    EUR 1270
    Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E04A2009-48 1 plate of 48 wells
    EUR 520
    Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E04A2009-96 1 plate of 96 wells
    EUR 685
    Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E09A2009-192T 192 tests
    EUR 1270
    Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E09A2009-48 1 plate of 48 wells
    EUR 520
    Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E09A2009-96 1 plate of 96 wells
    EUR 685
    Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E07A2009-192T 192 tests
    EUR 1270
    Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E07A2009-48 1 plate of 48 wells
    EUR 520
    Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E07A2009-96 1 plate of 96 wells
    EUR 685
    Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E08A2009-192T 192 tests
    EUR 1270
    Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E08A2009-48 1 plate of 48 wells
    EUR 520
    Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E08A2009-96 1 plate of 96 wells
    EUR 685
    Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E06A2009-192T 192 tests
    EUR 1270
    Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E06A2009-48 1 plate of 48 wells
    EUR 520
    Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit

    E06A2009-96 1 plate of 96 wells
    EUR 685
    Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

    Rat Squalene monooxygenase (SQLE) ELISA Kit

    abx392005-96tests 96 tests
    EUR 911

    Mouse Squalene monooxygenase (SQLE) ELISA Kit

    abx390641-96tests 96 tests
    EUR 911

    Tyrosine 3-monooxygenase (TH) ELISA Kit

    20-abx258488
    • EUR 7237.00
    • EUR 3855.00
    • EUR 895.00
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit

    GA-E0825RT-48T 48T
    EUR 317

    Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit

    GA-E0825RT-96T 96T
    EUR 496

    Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit

    QY-E10827 96T
    EUR 361

    Mouse Alkylglycerol Monooxygenase(AGMO)ELISA Kit

    QY-E20067 96T
    EUR 361

    YWHAE Tyr-3/Trp- 5 Monooxygenase Activation Protein Epsilon Human Recombinant Protein

    PROTP62258-1 Regular: 20ug
    EUR 317
    Description: YWHAE Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 255 amino acids (1-255) and having a molecular mass of 29 kDa. ;YWHAE is purified by proprietary chromatographic techniques.

    Luciferase Firefly, Luciferin 4-Monooxygenase Firefly Recombinant Protein, Active

    PROTP08659-1 Regular: 5ug
    EUR 317
    Description: Luciferase produced in E.Coli is a single, non-glycosylated polypeptide chain containing 335 amino acids (1-311 a.a) and having a molecular mass of 38.5kDa.; Luciferase is fused to a 24 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

    PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9

    PROTP11464-1 Regular: 10ug
    EUR 317
    Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.

    AXYPET STARTER KIT 1 AP-20, AP-200 & AP-1000 WITH ADDITIONAL FREE RACKS OF AXYGEN PIPETTE TIPS

    AP-STR-KIT-1 1/pk
    EUR 355
    Description: Corning and Axygen Liquid Handling Equipment; Axypet Pipettors and Motopet Pipet Controller

    Bcmo1 sgRNA CRISPR Lentivector (Rat) (Target 1)

    K7529202 1.0 ug DNA
    EUR 154

    Bcmo1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

    K3981802 1.0 ug DNA
    EUR 154

    Chicken DBH- like monooxygenase protein 1, MOXD1 ELISA KIT

    ELI-14227c 96 Tests
    EUR 928

    Mouse DBH- like monooxygenase protein 1, Moxd1 ELISA KIT

    ELI-38586m 96 Tests
    EUR 865

    BCMO1 sgRNA CRISPR Lentivector set (Human)

    K0177301 3 x 1.0 ug
    EUR 339

    Human Ubiquinone biosynthesis monooxygenase COQ6, COQ6 ELISA KIT

    ELI-09305h 96 Tests
    EUR 824

    Human Cholesterol 7- alpha- monooxygenase, CYP7A1 ELISA KIT

    ELI-03412h 96 Tests
    EUR 824

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    SEC744Hu-10x96wellstestplate 10x96-wells test plate
    EUR 4731.5
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids.

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    SEC744Hu-1x48wellstestplate 1x48-wells test plate
    EUR 477.3
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids.

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    SEC744Hu-1x96wellstestplate 1x96-wells test plate
    EUR 639
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids.

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    SEC744Hu-5x96wellstestplate 5x96-wells test plate
    EUR 2575.5
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids.

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    4-SEC744Hu
    • EUR 4782.00
    • EUR 2526.00
    • EUR 640.00
    • 10 plates of 96 wells
    • 5 plates of 96 wells
    • 1 plate of 96 wells
    Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.

    Human Flavin Containing Monooxygenase 2 (FMO2) ELISA Kit

    abx387386-96tests 96 tests
    EUR 911

    Human Flavin Containing Monooxygenase 5 (FMO5) ELISA Kit

    abx387387-96tests 96 tests
    EUR 911

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    20-abx152632
    • EUR 7378.00
    • EUR 3933.00
    • EUR 911.00
    • 10 Ă— 96 tests
    • 5 Ă— 96 tests
    • 96 tests

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    DLR-PAM-Hu-48T 48T
    EUR 517
    Description: A sandwich quantitative ELISA assay kit for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates or other biological fluids.

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    DLR-PAM-Hu-96T 96T
    EUR 673
    Description: A sandwich quantitative ELISA assay kit for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates or other biological fluids.

    Human Peptidylglycine Alpha Amidating Monooxygenase ELISA Kit (PAM)

    RK02013 96 Tests
    EUR 521

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    RD-PAM-Hu-48Tests 48 Tests
    EUR 521

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    RD-PAM-Hu-96Tests 96 Tests
    EUR 723

    ELISA kit for Human KMO (Kynurenine-3-Monooxygenase)

    ELK4176 1 plate of 96 wells
    EUR 432
    Description: A sandwich ELISA kit for detection of Kynurenine-3-Monooxygenase from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

    Human CYP7A1/ Cholesterol 7-alpha-monooxygenase ELISA Kit

    E0651Hu 1 Kit
    EUR 571

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    RDR-PAM-Hu-48Tests 48 Tests
    EUR 544

    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

    RDR-PAM-Hu-96Tests 96 Tests
    EUR 756

    ELISA kit for Human Cholesterol 7-alpha-monooxygenase

    EK2656 96 tests
    EUR 553
    Description: Enzyme-linked immunosorbent assay kit for quantification of Human Cholesterol 7-alpha-monooxygenase in samples from serum, plasma, tissue homogenates and other biological fluids.

    Human CYP7A1(Cholesterol 7-alpha-monooxygenase) ELISA Kit

    EH1191 96T
    EUR 524.1
    Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

    Sqle ELISA Kit| Rat Squalene monooxygenase ELISA Kit

    EF019365 96 Tests
    EUR 689

    Sqle ELISA Kit| Mouse Squalene monooxygenase ELISA Kit

    EF016284 96 Tests
    EUR 689

    Frit Kit

    FRIT-KIT 1each
    EUR 124
    Description: Kit to create frits in capillaries. Includes formamide, Kasil-1, Kasil-1624 and a cleaving tool.

    TPSAB1 Human, Tryptase Alpha/Beta 1 Human Recombinant Protein, Sf9

    PROTQ15661-1 Regular: 10ug
    EUR 317
    Description: TPSAB1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (31-275 a.a.) and fused to a 6 aa His Tag at C-terminus containing a total of 251 amino acids and having a molecular mass of 28.2kDa.TPSAB1 shows multiple bands between 28-40kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques. 

    ATP1B1 Human, ATPase Transporting Beta 1 Human Recombinant Protein, Sf9

    PROTP05026-1 Regular: 10ug
    EUR 317
    Description: ATP1B1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 250 amino acids (63-303 a.a.) and having a molecular mass of 29kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa).;ATP1B1 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.

    ATP1B2 Human, ATPase Transporting Beta 1 Human Recombinant Protein, Sf9

    PROTP14415-1 Regular: 10ug
    EUR 317
    Description: ATP1B2 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 232 amino acids (68-290a.a.) and having a molecular mass of 26.4kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa). ATP1B2 is expressed with a 9 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.

    ER beta-1 (Estrogen Receptor beta-1); Clone ERb455 (Concentrate)

    RA0111-C.1 0.1 ml
    EUR 125

    Methylsterol monooxygenase 1 (MSMO1) Antibody

    20-abx339329
    • EUR 411.00
    • EUR 300.00
    • 100 ul
    • 50 ul

    Methylsterol monooxygenase 1 (MSMO1) Antibody

    20-abx211004
    • EUR 411.00
    • EUR 300.00
    • 100 ul
    • 50 ul

    Methylsterol Monooxygenase 1 (ERG25) Antibody

    abx027706-400ul 400 ul
    EUR 523

    Methylsterol Monooxygenase 1 (ERG25) Antibody

    abx027706-80l 80 µl
    EUR 286

    flavin containing monooxygenase 1 antibody

    22997-100ul 100ul
    EUR 390