Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

To Order Contact us: 

    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit
    RDR-bCMO1-Hu-48Tests 48 Tests
    EUR 544
    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit
    RDR-bCMO1-Hu-96Tests 96 Tests
    EUR 756
    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit
    RD-bCMO1-Hu-48Tests 48 Tests
    EUR 521
    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit
    RD-bCMO1-Hu-96Tests 96 Tests
    EUR 723
    beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody
    abx025732-400ul 400 ul
    EUR 523
    • Shipped within 5-10 working days.
    beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody
    abx025732-80l 80 µl
    EUR 286
    • Shipped within 5-10 working days.
    Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Antibody
    20-abx130708
    • EUR 314.00
    • EUR 133.00
    • EUR 815.00
    • EUR 425.00
    • EUR 272.00
    • 100 ug
    • 10 ug
    • 1 mg
    • 200 ug
    • 50 ug
    • Shipped within 5-7 working days.
    beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody
    abx122471-100ug 100 ug
    EUR 391
    • Shipped within 5-10 working days.
    Beta-Carotene-15,15-Monooxygenase 1 (bCMO1) Antibody
    20-abx171410
    • EUR 857.00
    • EUR 439.00
    • 1 mg
    • 200 ug
    • Please enquire.
    beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody
    abx230851-100ug 100 ug
    EUR 481
    • Shipped within 5-12 working days.
    Recombinant Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1)
    4-RPE246Hu01
    • EUR 485.28
    • EUR 233.00
    • EUR 1544.80
    • EUR 581.60
    • EUR 1063.20
    • EUR 388.00
    • EUR 3712.00
    • 100 ug
    • 10ug
    • 1 mg
    • 200 ug
    • 500 ug
    • 50ug
    • 5 mg
    • Uniprot ID: Q9HAY6
    • Buffer composition: 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
    • Form: Freeze-dried powder
    • Predicted Molecular Mass (KD): 26.6kDa
    • Isoelectric Point: 8.9
    Description: Recombinant Human Beta-Carotene-15,15'-Monooxygenase 1 expressed in: E.coli
    Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit
    20-abx150797
    • EUR 7378.00
    • EUR 3933.00
    • EUR 911.00
    • 10 × 96 tests
    • 5 × 96 tests
    • 96 tests
    • Shipped within 5-7 working days.
    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit
    SEE246Hu-10x96wellstestplate 10x96-wells test plate
    EUR 4731.5
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10%
    • Inte
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.
    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit
    SEE246Hu-1x48wellstestplate 1x48-wells test plate
    EUR 477.3
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10%
    • Inte
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.
    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit
    SEE246Hu-1x96wellstestplate 1x96-wells test plate
    EUR 639
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10%
    • Inte
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.
    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit
    SEE246Hu-5x96wellstestplate 5x96-wells test plate
    EUR 2575.5
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10%
    • Inte
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.
    Human Beta,beta- carotene 15,15'- monooxygenase, BCMO1 ELISA KIT
    ELI-10937h 96 Tests
    EUR 824
    Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Protein
    20-abx650585
    • EUR 676.00
    • EUR 286.00
    • EUR 2082.00
    • EUR 801.00
    • EUR 481.00
    • 100 ug
    • 10 ug
    • 1 mg
    • 200 ug
    • 50 ug
    • Shipped within 5-7 working days.
    Mouse Beta,beta- carotene 15,15'- monooxygenase, Bcmo1 ELISA KIT
    ELI-11036m 96 Tests
    EUR 865
    Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) CLIA Kit
    20-abx494551
    • EUR 7973.00
    • EUR 4246.00
    • EUR 981.00
    • 10 × 96 tests
    • 5 × 96 tests
    • 96 tests
    • Please enquire.
    ELISA kit for Human bCMO1 (Beta-Carotene-15,15'-Monooxygenase 1)
    ELK4791 1 plate of 96 wells
    EUR 432
    • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Beta-Carotene-15,15'-Monooxygenase 1 (?CMO1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s
    • Show more
    Description: A sandwich ELISA kit for detection of Beta-Carotene-15,15'-Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
    Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) ELISA Kit
    4-SEE246Hu
    • EUR 4782.00
    • EUR 2526.00
    • EUR 640.00
    • 10 plates of 96 wells
    • 5 plates of 96 wells
    • 1 plate of 96 wells
    • Known also as Beta-Carotene-15, 15'-Monooxygenase 1 elisa. Alternative names of the recognized antigen: BCO1
    • BCDO
    • BCDO1
    • BCMO
    • Beta-carotene dioxygenase 1
    • Beta-carotene oxygenase 1
    • Beta, beta-carotene 15, 15'-monooxygenase
    Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.
    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human)
    4-PAE246Hu01
    • EUR 247.00
    • EUR 2510.00
    • EUR 625.00
    • EUR 310.00
    • EUR 214.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
    • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1)
    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC
    4-PAE246Hu01-APC
    • EUR 345.00
    • EUR 3275.00
    • EUR 912.00
    • EUR 440.00
    • EUR 219.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
    • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC.
    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Biotinylated
    4-PAE246Hu01-Biotin
    • EUR 311.00
    • EUR 2460.00
    • EUR 727.00
    • EUR 381.00
    • EUR 219.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
    • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Biotin.
    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Cy3
    4-PAE246Hu01-Cy3
    • EUR 419.00
    • EUR 4325.00
    • EUR 1175.00
    • EUR 545.00
    • EUR 251.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
    • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Cy3.
    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), FITC
    4-PAE246Hu01-FITC
    • EUR 296.00
    • EUR 2640.00
    • EUR 750.00
    • EUR 372.00
    • EUR 195.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
    • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with FITC.
    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), HRP
    4-PAE246Hu01-HRP
    • EUR 316.00
    • EUR 2855.00
    • EUR 807.00
    • EUR 398.00
    • EUR 206.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
    • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with HRP.
    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), PE
    4-PAE246Hu01-PE
    • EUR 296.00
    • EUR 2640.00
    • EUR 750.00
    • EUR 372.00
    • EUR 195.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
    • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with PE.
    Human Beta,beta-carotene 15,15'-dioxygenase (BCO1) ELISA Kit
    abx392200-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    Rat Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit
    abx391017-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    Mouse Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit
    abx388677-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC-Cy7
    4-PAE246Hu01-APC-Cy7
    • EUR 571.00
    • EUR 6430.00
    • EUR 1705.00
    • EUR 760.00
    • EUR 319.00
    • 100ul
    • 10ml
    • 1ml
    • 200ul
    • 20ul
    • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
    • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
    Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC-Cy7.
    Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody
    20-abx310811
    • EUR 411.00
    • EUR 1845.00
    • EUR 599.00
    • EUR 182.00
    • EUR 300.00
    • 100 ug
    • 1 mg
    • 200 ug
    • 20 ug
    • 50 ug
    • Shipped within 5-10 working days.
    Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (HRP)
    20-abx310812
    • EUR 411.00
    • EUR 1845.00
    • EUR 599.00
    • EUR 182.00
    • EUR 300.00
    • 100 ug
    • 1 mg
    • 200 ug
    • 20 ug
    • 50 ug
    • Shipped within 5-10 working days.
    Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (FITC)
    20-abx310813
    • EUR 411.00
    • EUR 1845.00
    • EUR 599.00
    • EUR 182.00
    • EUR 300.00
    • 100 ug
    • 1 mg
    • 200 ug
    • 20 ug
    • 50 ug
    • Shipped within 5-10 working days.
    Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (Biotin)
    20-abx310814
    • EUR 411.00
    • EUR 1845.00
    • EUR 599.00
    • EUR 182.00
    • EUR 300.00
    • 100 ug
    • 1 mg
    • 200 ug
    • 20 ug
    • 50 ug
    • Shipped within 5-10 working days.
    Human beta carotene
    QY-E05643 96T
    EUR 361
    beta-Carotene
    GP8334-10G 10 g
    EUR 102
    beta-Carotene
    GP8334-1G 1 g
    EUR 48
    beta-Carotene
    GP8334-25G 25 g
    EUR 174
    beta-Carotene
    GP8334-5G 5 g
    EUR 74
    Beta-Carotene
    TB0299 8XX100mg
    EUR 274
    Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed
    ELISA-1 1
    EUR 202
    Bcmo1/ Rat Bcmo1 ELISA Kit
    ELI-33406r 96 Tests
    EUR 886
    Human BCO2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit
    E0265Hu 1 Kit
    EUR 605
    Human Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit
    abx250481-96tests 96 tests
    EUR 668
    • Shipped within 5-12 working days.
    ELISA kit for Human Beta,beta-carotene 9',10'-oxygenase
    EK2713 96 tests
    EUR 553
    Description: Enzyme-linked immunosorbent assay kit for quantification of Human Beta,beta-carotene 9',10'-oxygenase in samples from serum, plasma, tissue homogenates and other biological fluids.
    Human BCO2(Beta,beta-carotene 9',10'-oxygenase) ELISA Kit
    EH1224 96T
    EUR 567.6
    • Detection range: 0.78-50 ng/ml
    • Uniprot ID: Q9BYV7
    • Alias: BCO2/Beta,beta-carotene 9',10'-oxygenase/B-diox-II/Beta-carotene dioxygenase 2
    Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.469 ng/ml
    Human Beta,beta- carotene 9',10'- oxygenase, BCO2 ELISA KIT
    ELI-49386h 96 Tests
    EUR 824
    Mouse Bco2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit
    E0170Mo 1 Kit
    EUR 632
    Mouse Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit
    abx515122-96tests 96 tests
    EUR 739
    • Shipped within 5-12 working days.
    Mouse Beta,beta- carotene 9',10'- oxygenase, Bco2 ELISA KIT
    ELI-49387m 96 Tests
    EUR 865
    Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit
    EI2200-1 96 Well Plate
    EUR 477
    BCMO1 ELISA Kit (Human) (OKCD04382)
    OKCD04382 96 Wells
    EUR 831
    Description: Description of target: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich ELISA;Sensitivity: 0.49 ng/mL
    Human TGF-beta-1 AssayMax ELISA Kit
    ET3102-1 96 Well Plate
    EUR 477
    Chicken BCMO1 ELISA KIT
    ELI-25375c 96 Tests
    EUR 928
    Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody
    20-abx003844
    • EUR 411.00
    • EUR 592.00
    • EUR 182.00
    • EUR 314.00
    • 100 ul
    • 200 ul
    • 20 ul
    • 50 ul
    • Shipped within 5-10 working days.
    Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody
    abx122472-100ug 100 ug
    EUR 391
    • Shipped within 5-10 working days.
    Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody
    abx230852-100ug 100 ug
    EUR 481
    • Shipped within 5-12 working days.
    Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit
    EMI2200-1 96 Well Plate
    EUR 477
    YWHAB Tyr-3/Trp- 5 Monooxygenase Activation Protein Beta Human Recombinant Protein
    PROTP31946-1 Regular: 25ug
    EUR 317
    Description: YWHAB Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and having a molecular mass of 28kDa. ;YWHAB is purified by proprietary chromatographic techniques.
    β-Carotene
    HY-N0411 50mg
    EUR 108
    alpha-Carotene
    TBZ2607 5mg Ask for price
    Human Methylsterol monooxygenase 1, MSMO1 ELISA KIT
    ELI-23191h 96 Tests
    EUR 824
    Human Methylsterol monooxygenase 1 (MSMO1) ELISA Kit
    abx385151-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    BCMO1 siRNA
    20-abx909008
    • EUR 551.00
    • EUR 732.00
    • 15 nmol
    • 30 nmol
    • Shipped within 5-10 working days.
    BCMO1 siRNA
    20-abx909009
    • EUR 551.00
    • EUR 732.00
    • 15 nmol
    • 30 nmol
    • Shipped within 5-10 working days.
    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
    DLR-FMO1-Hu-48T 48T
    EUR 517
    • Should the Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
    Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.
    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
    DLR-FMO1-Hu-96T 96T
    EUR 673
    • Should the Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
    Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.
    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
    20-abx151570
    • EUR 7378.00
    • EUR 3933.00
    • EUR 911.00
    • 10 × 96 tests
    • 5 × 96 tests
    • 96 tests
    • Shipped within 5-7 working days.
    Human Monooxygenase DBH Like 1 (MOXD1) ELISA Kit
    abx381498-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
    RDR-FMO1-Hu-48Tests 48 Tests
    EUR 544
    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
    RDR-FMO1-Hu-96Tests 96 Tests
    EUR 756
    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
    SEF458Hu-10x96wellstestplate 10x96-wells test plate
    EUR 4731.5
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Flavin Containing Monooxygenase 1 (FMO1) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10%
    • Inter-As
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.
    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
    SEF458Hu-1x48wellstestplate 1x48-wells test plate
    EUR 477.3
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Flavin Containing Monooxygenase 1 (FMO1) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10%
    • Inter-As
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.
    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
    SEF458Hu-1x96wellstestplate 1x96-wells test plate
    EUR 639
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Flavin Containing Monooxygenase 1 (FMO1) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10%
    • Inter-As
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.
    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
    SEF458Hu-5x96wellstestplate 5x96-wells test plate
    EUR 2575.5
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Flavin Containing Monooxygenase 1 (FMO1) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10%
    • Inter-As
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.
    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
    4-SEF458Hu
    • EUR 4782.00
    • EUR 2526.00
    • EUR 640.00
    • 10 plates of 96 wells
    • 5 plates of 96 wells
    • 1 plate of 96 wells
    • Known also as Flavin Containing Monooxygenase 1 elisa. Alternative names of the recognized antigen: Dimethylaniline oxidase 1
    • Fetal hepatic flavin-containing monooxygenase 1
    Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.
    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
    RD-FMO1-Hu-48Tests 48 Tests
    EUR 521
    Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
    RD-FMO1-Hu-96Tests 96 Tests
    EUR 723
    ExoAb Antibody Kit (CD9, CD63, CD81, Hsp70 antibodies, rabbit anti-human) with goat anti-rabbit HRP secondary antibody
    EXOAB-KIT-1 25 ul each
    EUR 627
    • Category: Exosomes
    mRNAExpress mRNA Synthesis kit (5 reactions)
    MR-KIT-1 5 reactions
    EUR 1152
    • Category: Stem Cell Products
    Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit
    201-12-2419 96 tests
    EUR 440
    • This Alkylglycerol Monooxygenase ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
    Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
    Human Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E01A2009-192T 192 tests
    EUR 1270
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Human Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E01A2009-48 1 plate of 48 wells
    EUR 520
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Human Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E01A2009-96 1 plate of 96 wells
    EUR 685
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Human SQLE/ Squalene monooxygenase ELISA Kit
    E2385Hu 1 Kit
    EUR 605
    Human Alkylglycerol monooxygenase, AGMO ELISA KIT
    ELI-24195h 96 Tests
    EUR 824
    Kynurenine 3-monooxygenase ELISA Kit|Human
    EF005180 96 Tests
    EUR 689
    Human Squalene monooxygenase, SQLE ELISA KIT
    ELI-32784h 96 Tests
    EUR 824
    Human Alkylglycerol Monooxygenase(AGMO)ELISA Kit
    QY-E01119 96T
    EUR 361
    PinPoint-FC 293T Platform Kit for Targeted Gene Insertion (includes PIN320A-1, PIN200A-1, PIN510A-1 & PIN600A-1)
    PIN320A-KIT 1 Kit
    EUR 4941
    • Category: PinPoint Integrase Tools
    Chicken Methylsterol monooxygenase 1, MSMO1 ELISA KIT
    ELI-23404c 96 Tests
    EUR 928
    Porcine Methylsterol monooxygenase 1, MSMO1 ELISA KIT
    ELI-42078p 96 Tests
    EUR 928
    Mouse Methylsterol monooxygenase 1, Msmo1 ELISA KIT
    ELI-45646m 96 Tests
    EUR 865
    Rat Methylsterol monooxygenase 1 (MSMO1) ELISA Kit
    abx391608-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    Mouse Methylsterol monooxygenase 1 (MSMO1) ELISA Kit
    abx389876-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    Human BCMO1 shRNA Plasmid
    20-abx959976
    • EUR 801.00
    • EUR 1121.00
    • 150 µg
    • 300 µg
    • Shipped within 15-20 working days.
    BCMO1 Recombinant Protein (Human)
    RP036973 100 ug Ask for price
    BCMO1 Recombinant Protein (Human)
    RP036976 100 ug Ask for price
    PinPoint-FC Murine iPSC Platform Kit for Targeted Gene Insertion (includes PIN340iPS-1, PIN200A-1, PIN510A-1 & PIN600A-1)
    PIN340iPS-KIT 1 Kit
    EUR 4941
    • Category: PinPoint Integrase Tools
    Human Beta-2-Microglobulin (B2M) AssayMax ELISA Kit
    EM5001-1 96 Well Plate
    EUR 417
    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody
    20-abx214774
    • EUR 411.00
    • EUR 300.00
    • 100 ul
    • 50 ul
    • Shipped within 5-10 working days.
    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody
    20-abx214826
    • EUR 411.00
    • EUR 300.00
    • 100 ul
    • 50 ul
    • Shipped within 5-10 working days.
    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody
    20-abx241015
    • EUR 411.00
    • EUR 300.00
    • 100 ul
    • 50 ul
    • Shipped within 5-10 working days.
    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody
    20-abx241094
    • EUR 411.00
    • EUR 300.00
    • 100 ul
    • 50 ul
    • Shipped within 5-10 working days.
    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody
    20-abx329250
    • EUR 314.00
    • EUR 244.00
    • 100 ug
    • 50 ug
    • Shipped within 5-10 working days.
    Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody
    abx332554-100ul 100 ul
    EUR 425
    • Shipped within 5-10 working days.
    Msmo1 ELISA Kit| Rat Methylsterol monooxygenase 1 ELISA Kit
    EF018966 96 Tests
    EUR 689
    Msmo1 ELISA Kit| Mouse Methylsterol monooxygenase 1 ELISA Kit
    EF015513 96 Tests
    EUR 689
    MSMO1 ELISA Kit| chicken Methylsterol monooxygenase 1 ELISA Kit
    EF012392 96 Tests
    EUR 689
    ELISA kit for Human FMO1 (Flavin Containing Monooxygenase 1)
    ELK4594 1 plate of 96 wells
    EUR 432
    • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Flavin Containing Monooxygenase 1 (FMO1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody speci
    • Show more
    Description: A sandwich ELISA kit for detection of Flavin Containing Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
    Human DBH- like monooxygenase protein 1, MOXD1 ELISA KIT
    ELI-43781h 96 Tests
    EUR 824
    Amyloid Beta-Peptide (1-40) (human)
    A1124-1 1 mg
    EUR 189
    Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
    Recombinant Human Heregulin Beta -1 Protein
    PROTQ02297-1 50ug
    EUR 317
    Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues).
    BCMO1 sgRNA CRISPR Lentivector (Human) (Target 1)
    K0177302 1.0 ug DNA
    EUR 154
    BCMO1 Polyclonal Antibody
    29452-100ul 100ul
    EUR 252
    BCMO1 Polyclonal Antibody
    29452-50ul 50ul
    EUR 187
    BCMO1 Rabbit pAb
    A15848-100ul 100 ul
    EUR 308
    BCMO1 Rabbit pAb
    A15848-200ul 200 ul
    EUR 459
    BCMO1 Rabbit pAb
    A15848-20ul 20 ul
    EUR 183
    BCMO1 Rabbit pAb
    A15848-50ul 50 ul
    EUR 223
    BCMO1 cloning plasmid
    CSB-CL864015HU1-10ug 10ug
    EUR 376
    • Formulation: 10 μg plasmid + 200μl Glycerol
    • Length: 1644
    • Sequence: atggatataatatttggcaggaataggaaagaacagctggagcctgtgagggccaaagtgacaggcaagattccagcatggctgcagggaaccctgctccgcaatgggcctgggatgcacacagttggggagtccagatacaaccattggttcgacggccttgccctgctccaca
    • Show more
    Description: A cloning plasmid for the BCMO1 gene.
    BCMO1 cloning plasmid
    CSB-CL864015HU2-10ug 10ug
    EUR 570
    • Formulation: 10 μg plasmid + 200μl Glycerol
    • Length: 1644
    • Sequence: atggatataatatttggcaggaataggaaagaacagctggagcctgtgagggccaaagtgacaggcaagattccagcatggctgcagggaaccctgctccgcaacgggcctgggatgcacacagttggggagtccagatacaaccattggttcgacggccttgccctgctccaca
    • Show more
    Description: A cloning plasmid for the BCMO1 gene.
    anti- BCMO1 antibody
    FNab00851 100µg
    EUR 505.25
    • Immunogen: beta-carotene 15,15'-monooxygenase 1
    • Uniprot ID: Q9HAY6
    • Gene ID: 53630
    • Research Area: Neuroscience, Metabolism
    Description: Antibody raised against BCMO1
    Anti-BCMO1 antibody
    PAab00851 100 ug
    EUR 355
    Beta-Amyloid (1-11)
    A1002-1 1 mg
    EUR 102
    Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein.
    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit
    DLR-KMO-Hu-48T 48T
    EUR 517
    • Should the Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
    Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids.
    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit
    DLR-KMO-Hu-96T 96T
    EUR 673
    • Should the Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
    Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids.
    Human Kynurenine 3 monooxygenase(KMO) ELISA kit
    E01K0092-192T 192 tests
    EUR 1270
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Human Kynurenine 3 monooxygenase(KMO) ELISA kit
    E01K0092-48 1 plate of 48 wells
    EUR 520
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Human Kynurenine 3 monooxygenase(KMO) ELISA kit
    E01K0092-96 1 plate of 96 wells
    EUR 685
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit
    20-abx152142
    • EUR 7378.00
    • EUR 3933.00
    • EUR 911.00
    • 10 × 96 tests
    • 5 × 96 tests
    • 96 tests
    • Shipped within 5-7 working days.
    Human KMO/ Kynurenine 3-monooxygenase ELISA Kit
    E1395Hu 1 Kit
    EUR 605
    Human TH/ Tyrosine 3-monooxygenase ELISA Kit
    E2487Hu 1 Kit
    EUR 571
    Human KMO(Kynurenine 3-monooxygenase) ELISA Kit
    EH14776 96T
    EUR 567.6
    • Detection range: 0.313-20 ng/ml
    • Uniprot ID: O15229
    Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml
    Human TH(Tyrosine 3-monooxygenase) ELISA Kit
    EH1602 96T
    EUR 524.1
    • Detection range: 0.313-20 ng/ml
    • Uniprot ID: P07101
    • Alias: TH(Tyrosine Hydroxylase)/TYH/DYT14/DYT5b/dystonia 14/Tyrosine 3-hydroxylase/Tyrosine 3-monooxygenase
    Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml
    Human Tyrosine 3- monooxygenase, TH ELISA KIT
    ELI-04696h 96 Tests
    EUR 824
    Human Kynurenine 3- monooxygenase, KMO ELISA KIT
    ELI-46405h 96 Tests
    EUR 824
    Human Kynurenine 3-monooxygenase (KMO) ELISA Kit
    abx573591-96tests 96 tests
    EUR 668
    • Shipped within 5-12 working days.
    Human Coenzyme Q6, Monooxygenase (COQ6) ELISA Kit
    abx386638-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    ELISA kit for Human Squalene monooxygenase (SQLE)
    KTE60353-48T 48T
    EUR 332
    • Squalene epoxidase (EC 1.14.99.7) catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway. Squalene epoxidase (SE) is a key flavin adenine dinucleotide (FAD)-dependent enzyme o
    • Show more
    Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
    ELISA kit for Human Squalene monooxygenase (SQLE)
    KTE60353-5platesof96wells 5 plates of 96 wells
    EUR 2115
    • Squalene epoxidase (EC 1.14.99.7) catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway. Squalene epoxidase (SE) is a key flavin adenine dinucleotide (FAD)-dependent enzyme o
    • Show more
    Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
    ELISA kit for Human Squalene monooxygenase (SQLE)
    KTE60353-96T 96T
    EUR 539
    • Squalene epoxidase (EC 1.14.99.7) catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway. Squalene epoxidase (SE) is a key flavin adenine dinucleotide (FAD)-dependent enzyme o
    • Show more
    Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
    Human Deoxyhypusine Hydroxylase/Monooxygenase(DOHH)ELISA Kit
    QY-E01153 96T
    EUR 361
    Human Kynurenine-3-Monooxygenase(KMO)ELISA Kit
    QY-E01801 96T
    EUR 361
    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit
    RDR-KMO-Hu-48Tests 48 Tests
    EUR 544
    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit
    RDR-KMO-Hu-96Tests 96 Tests
    EUR 756
    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit
    RD-KMO-Hu-48Tests 48 Tests
    EUR 521
    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit
    RD-KMO-Hu-96Tests 96 Tests
    EUR 723
    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit
    SEH755Hu-10x96wellstestplate 10x96-wells test plate
    EUR 4731.5
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Kynurenine-3-Monooxygenase (KMO) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10%
    • Inter-Assay: CV<
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.
    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit
    SEH755Hu-1x48wellstestplate 1x48-wells test plate
    EUR 477.3
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Kynurenine-3-Monooxygenase (KMO) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10%
    • Inter-Assay: CV<
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.
    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit
    SEH755Hu-1x96wellstestplate 1x96-wells test plate
    EUR 639
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Kynurenine-3-Monooxygenase (KMO) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10%
    • Inter-Assay: CV<
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.
    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit
    SEH755Hu-5x96wellstestplate 5x96-wells test plate
    EUR 2575.5
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Kynurenine-3-Monooxygenase (KMO) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10%
    • Inter-Assay: CV<
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.
    Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit
    4-SEH755Hu
    • EUR 4782.00
    • EUR 2526.00
    • EUR 640.00
    • 10 plates of 96 wells
    • 5 plates of 96 wells
    • 1 plate of 96 wells
    • Known also as Kynurenine-3-Monooxygenase elisa. Alternative names of the recognized antigen: Kynurenine 3-Hydroxylase
    Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.
    PinPoint-FC System for Platform Cell Line Generation & Retargeting (includes PIN300A-1, FC200PA-1, PIN200A-1, PIN510A-1, & PIN600A-1)
    PIN300A-KIT 1 Kit
    EUR 2798
    • Category: PinPoint Integrase Tools
    T7 gRNA SmartNuclease Synthesis Kit (includes CAS510A-1 & T7 IVT synthesis reagents)
    CAS510A-KIT 1 Kit
    EUR 805
    • Category: Cas9
    IL-1-beta Interleukin-1 beta Mouse Recombinant Protein, His Tag
    PROTP10749-1 Regular: 25ug
    EUR 317
    Description: Interleukin-1 beta Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 189 amino acids and having a molecular mass of 21 kDa. ;The IL-1b is fused to His-Tag and purified by proprietary chromatographic techniques.
    BCMO1 ORF Vector (Human) (pORF)
    ORF012325 1.0 ug DNA
    EUR 354
    BCMO1 ORF Vector (Human) (pORF)
    ORF012326 1.0 ug DNA
    EUR 354
    PinPoint-HR System for Platform Cell Line Generation & Retargeting (includes PIN400A-1, PIN200A-1, PIN510A-1, & PIN600A-1)
    PIN400A-KIT 1 Kit
    EUR 2798
    • Category: PinPoint Integrase Tools
    Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit
    E01D0299-192T 192 tests
    EUR 1270
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit
    E01D0299-48 1 plate of 48 wells
    EUR 520
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit
    E01D0299-96 1 plate of 96 wells
    EUR 685
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1)
    KTE61571-48T 48T
    EUR 332
    • MOXD1 (Monooxygenase DBH Like 1) is a Protein Coding gene. Diseases associated with MOXD1 include Mesenteric Lymphadenitis. GO annotations related to this gene include copper ion binding and oxidoreductase activity, acting on paired donors, with
    • Show more
    Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
    ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1)
    KTE61571-5platesof96wells 5 plates of 96 wells
    EUR 2115
    • MOXD1 (Monooxygenase DBH Like 1) is a Protein Coding gene. Diseases associated with MOXD1 include Mesenteric Lymphadenitis. GO annotations related to this gene include copper ion binding and oxidoreductase activity, acting on paired donors, with
    • Show more
    Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
    ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1)
    KTE61571-96T 96T
    EUR 539
    • MOXD1 (Monooxygenase DBH Like 1) is a Protein Coding gene. Diseases associated with MOXD1 include Mesenteric Lymphadenitis. GO annotations related to this gene include copper ion binding and oxidoreductase activity, acting on paired donors, with
    • Show more
    Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
    PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, GE601A-1, PIN200A-1, PIN510A-1, & PIN600A-1)
    PIN410A-KIT 1 Kit
    EUR 4335
    • Category: PinPoint Integrase Tools
    PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, CAS601A-1, PIN200A-1, PIN510A-1, & PIN600A-1)
    PIN412A-KIT 1 Kit
    EUR 4335
    • Category: PinPoint Integrase Tools
    Human Flavin Containing Monooxygenase 1 (FMO1) CLIA Kit
    20-abx494912
    • EUR 7973.00
    • EUR 4246.00
    • EUR 981.00
    • 10 × 96 tests
    • 5 × 96 tests
    • 96 tests
    • Please enquire.
    ITGB1 Human, Integrin Beta 1 Human Recombinant Protein, Sf9
    PROTP05556-1 Regular: 10ug
    EUR 317
    Description: ITGB1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 716 amino acids (1-728) and having a molecular mass of 79.4kDa (Molecular size on SDS-PAGE will appear at approximately 70-100kDa). ITGB1 is fused to an 8 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques. 
    Human SIRP BETA 1 (SIRP BETA 1) ELISA Kit
    abx259843-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    IL-1 beta, rat recombinant
    P1019-1 1 mg
    EUR 7288
    Description: Interleukin 1 beta (IL-1?) is a proinflammatory cytokine and is produced by activated macrophages, monocytes, keratinocytes and other epithelial cells. Both IL-1? and IL-1? bind to the same receptor and have similar biological properties.
    TGF-b-1 Transforming Growth Factor-beta 1 Human protein
    PROTP01137-1 Regular: 2.5ug
    EUR 1157
    Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.
    Luciferase Firefly, Luciferin 4-Monooxygenase Firefly Recombinant Protein, Active
    PROTP08659-1 Regular: 5ug
    EUR 317
    Description: Luciferase produced in E.Coli is a single, non-glycosylated polypeptide chain containing 335 amino acids (1-311 a.a) and having a molecular mass of 38.5kDa.; Luciferase is fused to a 24 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
    YWHAE Tyr-3/Trp- 5 Monooxygenase Activation Protein Epsilon Human Recombinant Protein
    PROTP62258-1 Regular: 20ug
    EUR 317
    Description: YWHAE Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 255 amino acids (1-255) and having a molecular mass of 29 kDa. ;YWHAE is purified by proprietary chromatographic techniques.
    AXYPET STARTER KIT 1 AP-20, AP-200 & AP-1000 WITH ADDITIONAL FREE RACKS OF AXYGEN PIPETTE TIPS
    AP-STR-KIT-1 1/pk
    EUR 355
    Description: Corning and Axygen Liquid Handling Equipment; Axypet Pipettors and Motopet Pipet Controller
    Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E03A2009-192T 192 tests
    EUR 1270
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E03A2009-48 1 plate of 48 wells
    EUR 520
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E03A2009-96 1 plate of 96 wells
    EUR 685
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E06A2009-192T 192 tests
    EUR 1270
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E06A2009-48 1 plate of 48 wells
    EUR 520
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E06A2009-96 1 plate of 96 wells
    EUR 685
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E04A2009-192T 192 tests
    EUR 1270
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E04A2009-48 1 plate of 48 wells
    EUR 520
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E04A2009-96 1 plate of 96 wells
    EUR 685
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E02A2009-192T 192 tests
    EUR 1270
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E02A2009-48 1 plate of 48 wells
    EUR 520
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E02A2009-96 1 plate of 96 wells
    EUR 685
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E07A2009-192T 192 tests
    EUR 1270
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E07A2009-48 1 plate of 48 wells
    EUR 520
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E07A2009-96 1 plate of 96 wells
    EUR 685
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Tyrosine 3-monooxygenase (TH) ELISA Kit
    20-abx258488
    • EUR 7237.00
    • EUR 3855.00
    • EUR 895.00
    • 10 × 96 tests
    • 5 × 96 tests
    • 96 tests
    • Shipped within 5-7 working days.
    Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E08A2009-192T 192 tests
    EUR 1270
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E08A2009-48 1 plate of 48 wells
    EUR 520
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E08A2009-96 1 plate of 96 wells
    EUR 685
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E09A2009-192T 192 tests
    EUR 1270
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E09A2009-48 1 plate of 48 wells
    EUR 520
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit
    E09A2009-96 1 plate of 96 wells
    EUR 685
    • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
    • Show more
    Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
    Mouse Alkylglycerol monooxygenase, Agmo ELISA KIT
    ELI-24173m 96 Tests
    EUR 865
    Mouse Squalene monooxygenase, Sqle ELISA KIT
    ELI-26561m 96 Tests
    EUR 865
    Rat Squalene monooxygenase (SQLE) ELISA Kit
    abx392005-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    Mouse Squalene monooxygenase (SQLE) ELISA Kit
    abx390641-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit
    GA-E0825RT-48T 48T
    EUR 317
    Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit
    GA-E0825RT-96T 96T
    EUR 496
    Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit
    QY-E10827 96T
    EUR 361
    Mouse Alkylglycerol Monooxygenase(AGMO)ELISA Kit
    QY-E20067 96T
    EUR 361
    PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9
    PROTP11464-1 Regular: 10ug
    EUR 317
    Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.
    Frit Kit
    FRIT-KIT 1each
    EUR 124
    Description: Kit to create frits in capillaries. Includes formamide, Kasil-1, Kasil-1624 and a cleaving tool.
    Sqle ELISA Kit| Rat Squalene monooxygenase ELISA Kit
    EF019365 96 Tests
    EUR 689
    Sqle ELISA Kit| Mouse Squalene monooxygenase ELISA Kit
    EF016284 96 Tests
    EUR 689
    Chicken DBH- like monooxygenase protein 1, MOXD1 ELISA KIT
    ELI-14227c 96 Tests
    EUR 928
    Mouse DBH- like monooxygenase protein 1, Moxd1 ELISA KIT
    ELI-38586m 96 Tests
    EUR 865
    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
    DLR-PAM-Hu-48T 48T
    EUR 517
    • Should the Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
    Description: A sandwich quantitative ELISA assay kit for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates or other biological fluids.
    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
    DLR-PAM-Hu-96T 96T
    EUR 673
    • Should the Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
    Description: A sandwich quantitative ELISA assay kit for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates or other biological fluids.
    Human CYP7A1/ Cholesterol 7-alpha-monooxygenase ELISA Kit
    E0651Hu 1 Kit
    EUR 571
    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
    20-abx152632
    • EUR 7378.00
    • EUR 3933.00
    • EUR 911.00
    • 10 × 96 tests
    • 5 × 96 tests
    • 96 tests
    • Shipped within 5-7 working days.
    ELISA kit for Human Cholesterol 7-alpha-monooxygenase
    EK2656 96 tests
    EUR 553
    Description: Enzyme-linked immunosorbent assay kit for quantification of Human Cholesterol 7-alpha-monooxygenase in samples from serum, plasma, tissue homogenates and other biological fluids.
    Human CYP7A1(Cholesterol 7-alpha-monooxygenase) ELISA Kit
    EH1191 96T
    EUR 524.1
    • Detection range: 0.313-20 ng/ml
    • Uniprot ID: P22680
    • Alias: CYP7A1(Cytochrome P450 7A1)/Cholesterol 7-alpha-monooxygenase/CYPVII/Cholesterol 7-alpha-hydroxylase
    Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml
    Human Ubiquinone biosynthesis monooxygenase COQ6, COQ6 ELISA KIT
    ELI-09305h 96 Tests
    EUR 824
    Human Cholesterol 7- alpha- monooxygenase, CYP7A1 ELISA KIT
    ELI-03412h 96 Tests
    EUR 824
    ELISA kit for Human KMO (Kynurenine-3-Monooxygenase)
    ELK4176 1 plate of 96 wells
    EUR 432
    • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Kynurenine-3-Monooxygenase (KMO). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to K
    • Show more
    Description: A sandwich ELISA kit for detection of Kynurenine-3-Monooxygenase from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
    Human Flavin Containing Monooxygenase 2 (FMO2) ELISA Kit
    abx387386-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    Human Flavin Containing Monooxygenase 5 (FMO5) ELISA Kit
    abx387387-96tests 96 tests
    EUR 911
    • Shipped within 5-12 working days.
    Human Peptidylglycine Alpha Amidating Monooxygenase ELISA Kit (PAM)
    RK02013 96 Tests
    EUR 521
    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
    SEC744Hu-10x96wellstestplate 10x96-wells test plate
    EUR 4731.5
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids.
    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
    SEC744Hu-1x48wellstestplate 1x48-wells test plate
    EUR 477.3
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids.
    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
    SEC744Hu-1x96wellstestplate 1x96-wells test plate
    EUR 639
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids.
    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
    SEC744Hu-5x96wellstestplate 5x96-wells test plate
    EUR 2575.5
    • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) were tested on 3 different plates, 8 replicates in each plate
    • CV(%) = SD/meanX100
    • Intra-Assay: CV<10
    • Show more
    Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids.
    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
    4-SEC744Hu
    • EUR 4782.00
    • EUR 2526.00
    • EUR 640.00
    • 10 plates of 96 wells
    • 5 plates of 96 wells
    • 1 plate of 96 wells
    • Known also as Peptidylglycine Alpha Amidating Monooxygenase elisa. Alternative names of the recognized antigen: PAL
    • PHM
    • Peptidylamidoglycolate lyase
    • Peptidyl-Alpha-hydroxyglycine Alpha-amidating Lyase
    • Peptidylglycine Alpha-Hydroxylating Monooxyge
    • Show more
    Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species.
    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
    RDR-PAM-Hu-48Tests 48 Tests
    EUR 544
    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
    RDR-PAM-Hu-96Tests 96 Tests
    EUR 756
    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
    RD-PAM-Hu-48Tests 48 Tests
    EUR 521
    Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
    RD-PAM-Hu-96Tests 96 Tests
    EUR 723
    TPSAB1 Human, Tryptase Alpha/Beta 1 Human Recombinant Protein, Sf9
    PROTQ15661-1 Regular: 10ug
    EUR 317
    Description: TPSAB1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (31-275 a.a.) and fused to a 6 aa His Tag at C-terminus containing a total of 251 amino acids and having a molecular mass of 28.2kDa.TPSAB1 shows multiple bands between 28-40kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques. 
    ATP1B1 Human, ATPase Transporting Beta 1 Human Recombinant Protein, Sf9
    PROTP05026-1 Regular: 10ug
    EUR 317
    Description: ATP1B1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 250 amino acids (63-303 a.a.) and having a molecular mass of 29kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa).;ATP1B1 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.
    ATP1B2 Human, ATPase Transporting Beta 1 Human Recombinant Protein, Sf9
    PROTP14415-1 Regular: 10ug
    EUR 317
    Description: ATP1B2 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 232 amino acids (68-290a.a.) and having a molecular mass of 26.4kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa). ATP1B2 is expressed with a 9 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.
    ER beta-1 (Estrogen Receptor beta-1); Clone ERb455 (Concentrate)
    RA0111-C.1 0.1 ml
    EUR 125
    Column Packing Kit
    PACK-KIT 1pack
    EUR 1035
    Description: Column packing kit for pressure cells. Includes: HPREG regulator, TBNG10 tubing, CAP-75 capillary, and STRB5X2 stir bar.
    Mouse BCMO1 shRNA Plasmid
    20-abx975231
    • EUR 801.00
    • EUR 1121.00
    • 150 µg
    • 300 µg
    • Shipped within 15-20 working days.
    BCMO1 Polyclonal Conjugated Antibody
    C29452 100ul
    EUR 397
    BCMO1 Recombinant Protein (Rat)
    RP192062 100 ug Ask for price
    BCMO1 Recombinant Protein (Mouse)
    RP119363 100 ug Ask for price
    BCMO1 Recombinant Protein (Mouse)
    RP119366 100 ug Ask for price
    Human Hexokinase-1 AssayMax ELISA Kit
    EH3101-1 96 Well Plate
    EUR 477
    Human Complexin-1 AssayMax ELISA Kit
    EC3505-1 96 Well Plate
    EUR 417
    Human Glutaredoxin-1 AssayMax ELISA Kit
    EG2153-1 96 Well Plate
    EUR 417
    IL-1-beta Interleukin-1 betaHuman Recombinant Protein
    PROTP01584-1 Regular: 10ug
    EUR 317
    Description: Interleukin-1 beta Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17000 Dalton.;The IL-1b is purified by proprietary chromatographic techniques.
    Recombinant Rat IL-1 Beta Protein
    PROTQ63264-1 10ug
    EUR 317
    Description: IL-1β is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1α and IL-1β binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1β is a secreted cytokine, IL-1α is predominantly a cell-associated cytokine. Recombinant rat IL-1β is a 17.4 kDa protein containing 153 amino acid residues.