Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit
Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit
To Order Contact us:
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
RDR-bCMO1-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 652.8 |
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
RDR-bCMO1-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 907.2 |
Beta-Carotene-15,15-Monooxygenase 1 (bCMO1) Antibody |
|||
20-abx171410 | Abbexa |
|
|
beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
|||
abx122471-100ug | Abbexa | 100 ug | EUR 469.2 |
Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Antibody |
|||
20-abx130708 | Abbexa |
|
|
beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
|||
abx025732-400ul | Abbexa | 400 ul | EUR 627.6 |
beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
|||
abx025732-80l | Abbexa | 80 µl | EUR 343.2 |
beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
|||
abx230851-100ug | Abbexa | 100 ug | EUR 577.2 |
Recombinant Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) |
|||
4-RPE246Hu01 | Cloud-Clone |
|
|
Description: Recombinant Human Beta-Carotene-15,15'-Monooxygenase 1 expressed in: E.coli |
Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
20-abx150797 | Abbexa |
|
|
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
SEE246Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 5677.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
SEE246Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 572.76 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
SEE246Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 766.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
SEE246Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 3090.6 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
Human Beta,beta- carotene 15,15'- monooxygenase, BCMO1 ELISA KIT |
|||
ELI-10937h | Lifescience Market | 96 Tests | EUR 988.8 |
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Protein |
|||
20-abx650585 | Abbexa |
|
|
Mouse Beta,beta- carotene 15,15'- monooxygenase, Bcmo1 ELISA KIT |
|||
ELI-11036m | Lifescience Market | 96 Tests | EUR 1038 |
Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) CLIA Kit |
|||
20-abx494551 | Abbexa |
|
|
ELISA kit for Human bCMO1 (Beta-Carotene-15,15'-Monooxygenase 1) |
|||
ELK4791 | ELK Biotech | 1 plate of 96 wells | EUR 518.4 |
Description: A sandwich ELISA kit for detection of Beta-Carotene-15,15'-Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
4-SEE246Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human) |
|||
4-PAE246Hu01 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) |
Human Beta,beta-carotene 15,15'-dioxygenase (BCO1) ELISA Kit |
|||
abx392200-96tests | Abbexa | 96 tests | EUR 1093.2 |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC |
|||
4-PAE246Hu01-APC | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC. |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Biotinylated |
|||
4-PAE246Hu01-Biotin | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Biotin. |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Cy3 |
|||
4-PAE246Hu01-Cy3 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Cy3. |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), FITC |
|||
4-PAE246Hu01-FITC | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with FITC. |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), HRP |
|||
4-PAE246Hu01-HRP | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with HRP. |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), PE |
|||
4-PAE246Hu01-PE | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with PE. |
Rat Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit |
|||
abx391017-96tests | Abbexa | 96 tests | EUR 1093.2 |
Mouse Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit |
|||
abx388677-96tests | Abbexa | 96 tests | EUR 1093.2 |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC-Cy7 |
|||
4-PAE246Hu01-APC-Cy7 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC-Cy7. |
Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody |
|||
20-abx310811 | Abbexa |
|
|
Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (HRP) |
|||
20-abx310812 | Abbexa |
|
|
Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (FITC) |
|||
20-abx310813 | Abbexa |
|
|
Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (Biotin) |
|||
20-abx310814 | Abbexa |
|
|
Human beta carotene |
|||
QY-E05643 | Qayee Biotechnology | 96T | EUR 433.2 |
beta-Carotene |
|||
GP8334-10G | Glentham Life Sciences | 10 g | EUR 122.4 |
beta-Carotene |
|||
GP8334-1G | Glentham Life Sciences | 1 g | EUR 57.6 |
beta-Carotene |
|||
GP8334-25G | Glentham Life Sciences | 25 g | EUR 208.8 |
beta-Carotene |
|||
GP8334-5G | Glentham Life Sciences | 5 g | EUR 88.8 |
Beta-Carotene |
|||
TB0299 | ChemNorm | 8XX100mg | EUR 328.8 |
Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed |
|||
ELISA-1 | Alpha Diagnostics | 1 | EUR 242.4 |
Bcmo1/ Rat Bcmo1 ELISA Kit |
|||
ELI-33406r | Lifescience Market | 96 Tests | EUR 1063.2 |
Human Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit |
|||
abx250481-96tests | Abbexa | 96 tests | EUR 801.6 |
Human BCO2(Beta,beta-carotene 9',10'-oxygenase) ELISA Kit |
|||
EH1224 | FN Test | 96T | EUR 681.12 |
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.469 ng/ml |
ELISA kit for Human Beta,beta-carotene 9',10'-oxygenase |
|||
EK2713 | SAB | 96 tests | EUR 663.6 |
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Beta,beta-carotene 9',10'-oxygenase in samples from serum, plasma, tissue homogenates and other biological fluids. |
Human Beta,beta- carotene 9',10'- oxygenase, BCO2 ELISA KIT |
|||
ELI-49386h | Lifescience Market | 96 Tests | EUR 988.8 |
Human BCO2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit |
|||
E0265Hu | Sunlong | 1 Kit | EUR 726 |
Mouse Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit |
|||
abx515122-96tests | Abbexa | 96 tests | EUR 886.8 |
Mouse Bco2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit |
|||
E0170Mo | Sunlong | 1 Kit | EUR 758.4 |
Mouse Beta,beta- carotene 9',10'- oxygenase, Bco2 ELISA KIT |
|||
ELI-49387m | Lifescience Market | 96 Tests | EUR 1038 |
Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit |
|||
EI2200-1 | AssayPro | 96 Well Plate | EUR 572.4 |
BCMO1 ELISA Kit (Human) (OKCD04382) |
|||
OKCD04382 | Aviva Systems Biology | 96 Wells | EUR 997.2 |
Description: Description of target: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich ELISA;Sensitivity: 0.49 ng/mL |
Human TGF-beta-1 AssayMax ELISA Kit |
|||
ET3102-1 | AssayPro | 96 Well Plate | EUR 572.4 |
Chicken BCMO1 ELISA KIT |
|||
ELI-25375c | Lifescience Market | 96 Tests | EUR 1113.6 |
Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit |
|||
EMI2200-1 | AssayPro | 96 Well Plate | EUR 572.4 |
Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody |
|||
20-abx003844 | Abbexa |
|
|
Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody |
|||
abx122472-100ug | Abbexa | 100 ug | EUR 469.2 |
Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody |
|||
abx230852-100ug | Abbexa | 100 ug | EUR 577.2 |
YWHAB Tyr-3/Trp- 5 Monooxygenase Activation Protein Beta Human Recombinant Protein |
|||
PROTP31946-1 | BosterBio | Regular: 25ug | EUR 380.4 |
Description: YWHAB Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and having a molecular mass of 28kDa. ;YWHAB is purified by proprietary chromatographic techniques. |
β-Carotene |
|||
HY-N0411 | MedChemExpress | 50mg | EUR 129.6 |
alpha-Carotene |
|||
TBZ2607 | ChemNorm | 5mg | Ask for price |
Human Methylsterol monooxygenase 1 (MSMO1) ELISA Kit |
|||
abx385151-96tests | Abbexa | 96 tests | EUR 1093.2 |
Human Methylsterol monooxygenase 1, MSMO1 ELISA KIT |
|||
ELI-23191h | Lifescience Market | 96 Tests | EUR 988.8 |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
20-abx151570 | Abbexa |
|
|
Human Monooxygenase DBH Like 1 (MOXD1) ELISA Kit |
|||
abx381498-96tests | Abbexa | 96 tests | EUR 1093.2 |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
DLR-FMO1-Hu-48T | DL Develop | 48T | EUR 620.4 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
DLR-FMO1-Hu-96T | DL Develop | 96T | EUR 807.6 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
SEF458Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 5677.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
SEF458Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 572.76 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
SEF458Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 766.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
SEF458Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 3090.6 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
4-SEF458Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
RDR-FMO1-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 652.8 |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
RDR-FMO1-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 907.2 |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
RD-FMO1-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 625.2 |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
RD-FMO1-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 867.6 |
ExoAb Antibody Kit (CD9, CD63, CD81, Hsp70 antibodies, rabbit anti-human) with goat anti-rabbit HRP secondary antibody |
|||
EXOAB-KIT-1 | SBI | 25 ul each | EUR 752.4 |
BCMO1 siRNA |
|||
20-abx909008 | Abbexa |
|
|
BCMO1 siRNA |
|||
20-abx909009 | Abbexa |
|
|
mRNAExpress mRNA Synthesis kit (5 reactions) |
|||
MR-KIT-1 | SBI | 5 reactions | EUR 1382.4 |
Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit |
|||
201-12-2419 | SunredBio | 96 tests | EUR 528 |
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E01A2009-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E01A2009-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E01A2009-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human SQLE/ Squalene monooxygenase ELISA Kit |
|||
E2385Hu | Sunlong | 1 Kit | EUR 726 |
Kynurenine 3-monooxygenase ELISA Kit|Human |
|||
EF005180 | Lifescience Market | 96 Tests | EUR 826.8 |
Human Alkylglycerol monooxygenase, AGMO ELISA KIT |
|||
ELI-24195h | Lifescience Market | 96 Tests | EUR 988.8 |
Human Squalene monooxygenase, SQLE ELISA KIT |
|||
ELI-32784h | Lifescience Market | 96 Tests | EUR 988.8 |
Human Alkylglycerol Monooxygenase(AGMO)ELISA Kit |
|||
QY-E01119 | Qayee Biotechnology | 96T | EUR 433.2 |
Human Beta-2-Microglobulin (B2M) AssayMax ELISA Kit |
|||
EM5001-1 | AssayPro | 96 Well Plate | EUR 500.4 |
PinPoint-FC 293T Platform Kit for Targeted Gene Insertion (includes PIN320A-1, PIN200A-1, PIN510A-1 & PIN600A-1) |
|||
PIN320A-KIT | SBI | 1 Kit | EUR 5929.2 |
Rat Methylsterol monooxygenase 1 (MSMO1) ELISA Kit |
|||
abx391608-96tests | Abbexa | 96 tests | EUR 1093.2 |
Mouse Methylsterol monooxygenase 1 (MSMO1) ELISA Kit |
|||
abx389876-96tests | Abbexa | 96 tests | EUR 1093.2 |
Chicken Methylsterol monooxygenase 1, MSMO1 ELISA KIT |
|||
ELI-23404c | Lifescience Market | 96 Tests | EUR 1113.6 |
Mouse Methylsterol monooxygenase 1, Msmo1 ELISA KIT |
|||
ELI-45646m | Lifescience Market | 96 Tests | EUR 1038 |
Porcine Methylsterol monooxygenase 1, MSMO1 ELISA KIT |
|||
ELI-42078p | Lifescience Market | 96 Tests | EUR 1113.6 |
PinPoint-FC Murine iPSC Platform Kit for Targeted Gene Insertion (includes PIN340iPS-1, PIN200A-1, PIN510A-1 & PIN600A-1) |
|||
PIN340iPS-KIT | SBI | 1 Kit | EUR 5929.2 |
Human BCMO1 shRNA Plasmid |
|||
20-abx959976 | Abbexa |
|
|
BCMO1 Recombinant Protein (Human) |
|||
RP036973 | ABM | 100 ug | Ask for price |
BCMO1 Recombinant Protein (Human) |
|||
RP036976 | ABM | 100 ug | Ask for price |
Msmo1 ELISA Kit| Mouse Methylsterol monooxygenase 1 ELISA Kit |
|||
EF015513 | Lifescience Market | 96 Tests | EUR 826.8 |
MSMO1 ELISA Kit| chicken Methylsterol monooxygenase 1 ELISA Kit |
|||
EF012392 | Lifescience Market | 96 Tests | EUR 826.8 |
Msmo1 ELISA Kit| Rat Methylsterol monooxygenase 1 ELISA Kit |
|||
EF018966 | Lifescience Market | 96 Tests | EUR 826.8 |
ELISA kit for Human FMO1 (Flavin Containing Monooxygenase 1) |
|||
ELK4594 | ELK Biotech | 1 plate of 96 wells | EUR 518.4 |
Description: A sandwich ELISA kit for detection of Flavin Containing Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Human DBH- like monooxygenase protein 1, MOXD1 ELISA KIT |
|||
ELI-43781h | Lifescience Market | 96 Tests | EUR 988.8 |
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
abx332554-100ul | Abbexa | 100 ul | EUR 510 |
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx329250 | Abbexa |
|
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx241015 | Abbexa |
|
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx241094 | Abbexa |
|
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx214774 | Abbexa |
|
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx214826 | Abbexa |
|
|
Amyloid Beta-Peptide (1-40) (human) |
|||
A1124-1 | ApexBio | 1 mg | EUR 226.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Recombinant Human Heregulin Beta -1 Protein |
|||
PROTQ02297-1 | BosterBio | 50ug | EUR 380.4 |
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues). |
Rat Kynurenine 3-monooxygenase(KMO) ELISA kit |
|||
1-CSB-EL012475RA | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Rat Kynurenine 3-monooxygenase(KMO) in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human Genomic DNAÂ |
|||
X11000 | EpiGentek |
|
|
BCMO1 sgRNA CRISPR Lentivector (Human) (Target 1) |
|||
K0177302 | ABM | 1.0 ug DNA | EUR 184.8 |
Human Brain Genomic DNAÂ Â |
|||
X11001 | EpiGentek |
|
|
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
20-abx152142 | Abbexa |
|
|
Human Kynurenine 3-monooxygenase (KMO) ELISA Kit |
|||
abx573591-96tests | Abbexa | 96 tests | EUR 801.6 |
Human Coenzyme Q6, Monooxygenase (COQ6) ELISA Kit |
|||
abx386638-96tests | Abbexa | 96 tests | EUR 1093.2 |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
DLR-KMO-Hu-48T | DL Develop | 48T | EUR 620.4 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids. |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
DLR-KMO-Hu-96T | DL Develop | 96T | EUR 807.6 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids. |
Human Kynurenine 3 monooxygenase(KMO) ELISA kit |
|||
E01K0092-192T | BlueGene | 192 tests | EUR 1524 |
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Kynurenine 3 monooxygenase(KMO) ELISA kit |
|||
E01K0092-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Kynurenine 3 monooxygenase(KMO) ELISA kit |
|||
E01K0092-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human KMO(Kynurenine 3-monooxygenase) ELISA Kit |
|||
EH14776 | FN Test | 96T | EUR 681.12 |
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
Human TH(Tyrosine 3-monooxygenase) ELISA Kit |
|||
EH1602 | FN Test | 96T | EUR 628.92 |
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
Human KMO/ Kynurenine 3-monooxygenase ELISA Kit |
|||
E1395Hu | Sunlong | 1 Kit | EUR 726 |
Human TH/ Tyrosine 3-monooxygenase ELISA Kit |
|||
E2487Hu | Sunlong | 1 Kit | EUR 685.2 |
Human Kynurenine 3- monooxygenase, KMO ELISA KIT |
|||
ELI-46405h | Lifescience Market | 96 Tests | EUR 988.8 |
ELISA kit for Human Squalene monooxygenase (SQLE) |
|||
KTE60353-48T | Abbkine | 48T | EUR 398.4 |
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Squalene monooxygenase (SQLE) |
|||
KTE60353-5platesof96wells | Abbkine | 5 plates of 96 wells | EUR 2538 |
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Squalene monooxygenase (SQLE) |
|||
KTE60353-96T | Abbkine | 96T | EUR 646.8 |
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
Human Tyrosine 3- monooxygenase, TH ELISA KIT |
|||
ELI-04696h | Lifescience Market | 96 Tests | EUR 988.8 |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
SEH755Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 5677.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
SEH755Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 572.76 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
SEH755Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 766.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
SEH755Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 3090.6 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
4-SEH755Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
RDR-KMO-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 652.8 |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
RDR-KMO-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 907.2 |
Human Deoxyhypusine Hydroxylase/Monooxygenase(DOHH)ELISA Kit |
|||
QY-E01153 | Qayee Biotechnology | 96T | EUR 433.2 |
Human Kynurenine-3-Monooxygenase(KMO)ELISA Kit |
|||
QY-E01801 | Qayee Biotechnology | 96T | EUR 433.2 |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
RD-KMO-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 625.2 |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
|||
RD-KMO-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 867.6 |
Beta-Amyloid (1-11) |
|||
A1002-1 | ApexBio | 1 mg | EUR 122.4 |
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein. |
BCMO1 Polyclonal Antibody |
|||
29452-100ul | SAB | 100ul | EUR 302.4 |
BCMO1 Polyclonal Antibody |
|||
29452-50ul | SAB | 50ul | EUR 224.4 |
BCMO1 Rabbit pAb |
|||
A15848-100ul | Abclonal | 100 ul | EUR 369.6 |
BCMO1 Rabbit pAb |
|||
A15848-200ul | Abclonal | 200 ul | EUR 550.8 |
BCMO1 Rabbit pAb |
|||
A15848-20ul | Abclonal | 20 ul | EUR 219.6 |
BCMO1 Rabbit pAb |
|||
A15848-50ul | Abclonal | 50 ul | EUR 267.6 |
BCMO1 cloning plasmid |
|||
CSB-CL864015HU1-10ug | Cusabio | 10ug | EUR 451.2 |
Description: A cloning plasmid for the BCMO1 gene. |
BCMO1 cloning plasmid |
|||
CSB-CL864015HU2-10ug | Cusabio | 10ug | EUR 684 |
Description: A cloning plasmid for the BCMO1 gene. |
Anti-BCMO1 antibody |
|||
PAab00851 | Lifescience Market | 100 ug | EUR 426 |
anti- BCMO1 antibody |
|||
FNab00851 | FN Test | 100µg | EUR 606.3 |
Description: Antibody raised against BCMO1 |
BCMO1 Polyclonal Antibody |
|||
A72807-050 | EpiGentek | 50 ul | EUR 302.5 |
BCMO1 Polyclonal Antibody |
|||
A72807-100 | EpiGentek | 100 ul | EUR 423.5 |
BCMO1 Polyclonal Antibody |
|||
A72807 | EpiGentek |
|
|
Human Lithostathine-1-beta(REG1B) ELISA kit |
|||
1-CSB-EL019547HU | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Lithostathine-1-beta(REG1B) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human Integrin beta-1(ITGB1) ELISA kit |
|||
1-CSB-EL011880HU | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Integrin beta-1(ITGB1) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
T7 gRNA SmartNuclease Synthesis Kit (includes CAS510A-1 & T7 IVT synthesis reagents) |
|||
CAS510A-KIT | SBI | 1 Kit | EUR 966 |
PinPoint-FC System for Platform Cell Line Generation & Retargeting (includes PIN300A-1, FC200PA-1, PIN200A-1, PIN510A-1, & PIN600A-1) |
|||
PIN300A-KIT | SBI | 1 Kit | EUR 3357.6 |
Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit |
|||
E01D0299-192T | BlueGene | 192 tests | EUR 1524 |
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit |
|||
E01D0299-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit |
|||
E01D0299-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1) |
|||
KTE61571-48T | Abbkine | 48T | EUR 398.4 |
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1) |
|||
KTE61571-5platesof96wells | Abbkine | 5 plates of 96 wells | EUR 2538 |
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1) |
|||
KTE61571-96T | Abbkine | 96T | EUR 646.8 |
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
PinPoint-HR System for Platform Cell Line Generation & Retargeting (includes PIN400A-1, PIN200A-1, PIN510A-1, & PIN600A-1) |
|||
PIN400A-KIT | SBI | 1 Kit | EUR 3357.6 |
IL-1-beta Interleukin-1 beta Mouse Recombinant Protein, His Tag |
|||
PROTP10749-1 | BosterBio | Regular: 25ug | EUR 380.4 |
Description: Interleukin-1 beta Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 189 amino acids and having a molecular mass of 21 kDa. ;The IL-1b is fused to His-Tag and purified by proprietary chromatographic techniques. |
BCMO1 ORF Vector (Human) (pORF) |
|||
ORF012325 | ABM | 1.0 ug DNA | EUR 424.8 |
BCMO1 ORF Vector (Human) (pORF) |
|||
ORF012326 | ABM | 1.0 ug DNA | EUR 424.8 |
Mouse Cholesterol 7-alpha-monooxygenase(CYP7A1) ELISA kit |
|||
1-CSB-EL006460MO | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Cholesterol 7-alpha-monooxygenase(CYP7A1) in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, GE601A-1, PIN200A-1, PIN510A-1, & PIN600A-1) |
|||
PIN410A-KIT | SBI | 1 Kit | EUR 5202 |
PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, CAS601A-1, PIN200A-1, PIN510A-1, & PIN600A-1) |
|||
PIN412A-KIT | SBI | 1 Kit | EUR 5202 |
Human Kynurenine 3-monooxygenase (KMO) |
|||
1-CSB-EP012475HU | Cusabio |
|
|
Description: Recombinant Human Kynurenine 3-monooxygenase(KMO) expressed in E.coli |
Human Kynurenine 3-monooxygenase (KMO) |
|||
1-CSB-EP012475HUa0 | Cusabio |
|
|
Description: Recombinant Human Kynurenine 3-monooxygenase(KMO) expressed in E.coli |
Human Kynurenine 3-monooxygenase (KMO) |
|||
1-CSB-EP012475HUb0 | Cusabio |
|
|
Description: Recombinant Human Kynurenine 3-monooxygenase(KMO) expressed in E.coli |
Human Kynurenine 3-monooxygenase (KMO) |
|||
1-CSB-YP012475HU | Cusabio |
|
|
Description: Recombinant Human Kynurenine 3-monooxygenase(KMO) expressed in Yeast |
Human Flavin Containing Monooxygenase 1 (FMO1) CLIA Kit |
|||
20-abx494912 | Abbexa |
|
|
Human SIRP BETA 1 (SIRP BETA 1) ELISA Kit |
|||
abx259843-96tests | Abbexa | 96 tests | EUR 1093.2 |
ITGB1 Human, Integrin Beta 1 Human Recombinant Protein, Sf9 |
|||
PROTP05556-1 | BosterBio | Regular: 10ug | EUR 380.4 |
Description: ITGB1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 716 amino acids (1-728) and having a molecular mass of 79.4kDa (Molecular size on SDS-PAGE will appear at approximately 70-100kDa). ITGB1 is fused to an 8 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques.  |
AXYPET STARTER KIT 1 AP-20, AP-200 & AP-1000 WITH ADDITIONAL FREE RACKS OF AXYGEN PIPETTE TIPS |
|||
AP-STR-KIT-1 | CORNING | 1/pk | EUR 426 |
Description: Corning and Axygen Liquid Handling Equipment; Axypet Pipettors and Motopet Pipet Controller |
Human Beta-1, 4-galactosyltransferase 1(B4GALT1) ELISA kit |
|||
1-CSB-EL002513HU | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Beta-1, 4-galactosyltransferase 1(B4GALT1) in samples from serum, plasma, cell lysates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Frit Kit |
|||
FRIT-KIT | Next Advance | 1each | EUR 148.8 |
Description: Kit to create frits in capillaries. Includes formamide, Kasil-1, Kasil-1624 and a cleaving tool. |
Tyrosine 3-monooxygenase (TH) ELISA Kit |
|||
20-abx258488 | Abbexa |
|
|
Mouse Squalene monooxygenase (SQLE) ELISA Kit |
|||
abx390641-96tests | Abbexa | 96 tests | EUR 1093.2 |
Rat Squalene monooxygenase (SQLE) ELISA Kit |
|||
abx392005-96tests | Abbexa | 96 tests | EUR 1093.2 |
Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E04A2009-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E04A2009-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E04A2009-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E07A2009-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E07A2009-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E07A2009-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E06A2009-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E06A2009-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E06A2009-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E03A2009-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E03A2009-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E03A2009-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E08A2009-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E08A2009-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E08A2009-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Alkylglycerol monooxygenase, Agmo ELISA KIT |
|||
ELI-24173m | Lifescience Market | 96 Tests | EUR 1038 |
Mouse Squalene monooxygenase, Sqle ELISA KIT |
|||
ELI-26561m | Lifescience Market | 96 Tests | EUR 1038 |
Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E02A2009-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E02A2009-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E02A2009-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit |
|||
GA-E0825RT-48T | GenAsia Biotech | 48T | EUR 380.4 |
Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit |
|||
GA-E0825RT-96T | GenAsia Biotech | 96T | EUR 595.2 |
Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E09A2009-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E09A2009-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E09A2009-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit |
|||
QY-E10827 | Qayee Biotechnology | 96T | EUR 433.2 |
Mouse Alkylglycerol Monooxygenase(AGMO)ELISA Kit |
|||
QY-E20067 | Qayee Biotechnology | 96T | EUR 433.2 |
TGF-b-1 Transforming Growth Factor-beta 1 Human protein |
|||
PROTP01137-1 | BosterBio | Regular: 2.5ug | EUR 1388.4 |
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques. |
YWHAE Tyr-3/Trp- 5 Monooxygenase Activation Protein Epsilon Human Recombinant Protein |
|||
PROTP62258-1 | BosterBio | Regular: 20ug | EUR 380.4 |
Description: YWHAE Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 255 amino acids (1-255) and having a molecular mass of 29 kDa. ;YWHAE is purified by proprietary chromatographic techniques. |
Luciferase Firefly, Luciferin 4-Monooxygenase Firefly Recombinant Protein, Active |
|||
PROTP08659-1 | BosterBio | Regular: 5ug | EUR 380.4 |
Description: Luciferase produced in E.Coli is a single, non-glycosylated polypeptide chain containing 335 amino acids (1-311 a.a) and having a molecular mass of 38.5kDa.; Luciferase is fused to a 24 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques. |
IL-1 beta, rat recombinant |
|||
P1019-1 | ApexBio | 1 mg | EUR 8745.6 |
Description: Interleukin 1 beta (IL-1?) is a proinflammatory cytokine and is produced by activated macrophages, monocytes, keratinocytes and other epithelial cells. Both IL-1? and IL-1? bind to the same receptor and have similar biological properties. |
Sqle ELISA Kit| Mouse Squalene monooxygenase ELISA Kit |
|||
EF016284 | Lifescience Market | 96 Tests | EUR 826.8 |
Sqle ELISA Kit| Rat Squalene monooxygenase ELISA Kit |
|||
EF019365 | Lifescience Market | 96 Tests | EUR 826.8 |
PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9 |
|||
PROTP11464-1 | BosterBio | Regular: 10ug | EUR 380.4 |
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques. |
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
20-abx152632 | Abbexa |
|
|
Human Flavin Containing Monooxygenase 2 (FMO2) ELISA Kit |
|||
abx387386-96tests | Abbexa | 96 tests | EUR 1093.2 |
Human Flavin Containing Monooxygenase 5 (FMO5) ELISA Kit |
|||
abx387387-96tests | Abbexa | 96 tests | EUR 1093.2 |
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
DLR-PAM-Hu-48T | DL Develop | 48T | EUR 620.4 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
DLR-PAM-Hu-96T | DL Develop | 96T | EUR 807.6 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates or other biological fluids. |
ELISA kit for Human KMO (Kynurenine-3-Monooxygenase) |
|||
ELK4176 | ELK Biotech | 1 plate of 96 wells | EUR 518.4 |
Description: A sandwich ELISA kit for detection of Kynurenine-3-Monooxygenase from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Human CYP7A1(Cholesterol 7-alpha-monooxygenase) ELISA Kit |
|||
EH1191 | FN Test | 96T | EUR 628.92 |
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
ELISA kit for Human Cholesterol 7-alpha-monooxygenase |
|||
EK2656 | SAB | 96 tests | EUR 663.6 |
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Cholesterol 7-alpha-monooxygenase in samples from serum, plasma, tissue homogenates and other biological fluids. |
Human CYP7A1/ Cholesterol 7-alpha-monooxygenase ELISA Kit |
|||
E0651Hu | Sunlong | 1 Kit | EUR 685.2 |
Human Cholesterol 7- alpha- monooxygenase, CYP7A1 ELISA KIT |
|||
ELI-03412h | Lifescience Market | 96 Tests | EUR 988.8 |
Human Ubiquinone biosynthesis monooxygenase COQ6, COQ6 ELISA KIT |
|||
ELI-09305h | Lifescience Market | 96 Tests | EUR 988.8 |
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
RD-PAM-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 625.2 |
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
RD-PAM-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 867.6 |
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
RDR-PAM-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 652.8 |
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
RDR-PAM-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 907.2 |
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
SEC744Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 5677.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids. |
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
SEC744Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 572.76 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids. |
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
SEC744Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 766.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids. |
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
SEC744Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 3090.6 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in serum, plasma, tissue homogenates and other biological fluids. |
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit |
|||
4-SEC744Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Peptidylglycine Alpha Amidating Monooxygenase ELISA Kit (PAM) |
|||
RK02013 | Abclonal | 96 Tests | EUR 625.2 |
Human Hexokinase-1 AssayMax ELISA Kit |
|||
EH3101-1 | AssayPro | 96 Well Plate | EUR 572.4 |
Human Glutaredoxin-1 AssayMax ELISA Kit |
|||
EG2153-1 | AssayPro | 96 Well Plate | EUR 500.4 |
Human Complexin-1 AssayMax ELISA Kit |
|||
EC3505-1 | AssayPro | 96 Well Plate | EUR 500.4 |
Column Packing Kit |
|||
PACK-KIT | Next Advance | 1pack | EUR 1242 |
Description: Column packing kit for pressure cells. Includes: HPREG regulator, TBNG10 tubing, CAP-75 capillary, and STRB5X2 stir bar. |
Human Tubulin beta-1 chain(TUBB1) ELISA kit |
|||
1-CSB-EL025319HU | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Tubulin beta-1 chain(TUBB1) in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |